CAZyme Information: CC1G_11283-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_11283-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		61941.26	4.9882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1544975-1548135(-)

Full Sequence      

MVLGRRLIVPFALLGNAYTALGGLVQKPDLVVPPAYRPYRDVVVKMFEDSYGAYKKYAWG
EDEVYPLKRGGGNTRNGWGATIVDSLSTMYIMGLEDLFLEGVEYSQNIDFSESKIRTDKV
SVFETTIRFLGGLLSAYELSEGKHPGLLEKATQLTDKMAYAWVGNNNIPHGFLNFTTNEP
FIDRTNIAEAGTLLLEWSTLSKYTGNSTYEELTLRAQRHMASLPSPLPGLAPIWIDPDRG
EWIGGYITWGGAGDSFYEYLIKYPRLSNTNDLLFADVWATAVDSSIKYLMKRSTVGNFTY
LADYDSNRQVRNIGSHLACFHGGNWIYGGRLINNETIVNYGLDLVEGCWNTYNGTQTGIG
PESFGYISDEGDYNGDGPITESQLSLYNRTGFYPRTAGYILRPEVLESNFYAWRATGDTK
YLDRAVHAVEAFNKYLRVESGGYTGITDVNQLFGPRYDYTESFWYAETLKYLYLTFDDPT
HISVDEWVFNTEAHPFKAPPPKTTYSSGPRQRINPEPFVLKGHEEDPTYTFSARKGSPTS
ANRYRDTFN

Enzyme Prediction     

No EC number prediction in CC1G_11283-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	46	497	2.3e-131	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.22e-173	46	497	1	452	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.52e-123	40	501	73	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW21493.1|GH47	5.73e-165	13	513	7	495
QRV84818.1|GH47	5.53e-161	6	507	3	492
QRV98862.1|GH47	5.53e-161	6	507	3	492
QRW21492.1|GH47	9.86e-161	25	493	19	485
QRW05096.1|GH47	1.54e-159	46	533	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	8.17e-95	6	495	2	505	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	8.19e-95	41	495	7	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	1.55e-88	38	496	13	490	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	9.01e-75	37	496	20	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.14e-74	37	496	18	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CP08|MNS1B_ASPCL	3.67e-106	20	497	7	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.63e-101	41	497	44	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	2.11e-101	41	497	42	507	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	2.11e-101	41	497	42	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q12563|MNS1B_ASPPH	9.05e-101	41	497	44	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.820156	0.179844

TMHMM  Annotations     

There is no transmembrane helices in CC1G_11283-t26_1-p1.