CAZyme Information: CC1G_11270-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_11270-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: chitin synthase 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2130		233856.53	7.1658

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1580994-1588053(+)

Full Sequence      

MSNPQSRRASGGFTSSTHPNNNNNDSSNERGHPSLSALESTSNLSTLPTTSLTDDTLVSC
LRERFMTDTIYTAIGTNSLVVVNPHKYVGCNSDSVVYKYAAEYADMGVCENVLVGEGVEG
GGAGKKMPPHVFQLANNAYYHMRRTGQDQCIIFTGETASGKSEARRLAIKSLITLSVPPA
GKKGSKLAQQIPASEFVLESFGNARTLFNPNASRFGKYTELQFTNIYGGVEKGGRRGRLC
GVKTLDYYLERGRVAAVPSGERNFHIFYYLVRGVNDDERGHLNLGDGRNFRYLGGQRASI
GGAHGLAGRFGHHSQPSGPGGHAGVPGRDEDALKFDQLKIALKTIGFSKRSVAQCMQLVA
AILHLGNLDFTIDKSRNEDAAVVRNLDTLNLVADFLGVDPQGLEGALSYKTKMVKKELCT
VFLDVEGAEANRDELAKTLYSLLFAWVNEYVNQRLAVEEGGAGGDGDFDAFIGLLDLPGP
QNMSSRPNSLDQFIVNYANERVQGFVRNKIFNGNQQEFQFEGLTHLLPSLSSLSTPDNSE
TLRLLHNYPGGLIHIMDDQARRQPKKTDGTMVEAFQKRWGNHSSFKTSGVVDVAGAGRAA
GAVHASGVGASFTVSHYNGAVTYAVEGFLERNLDSVNPDFVSLLRGTAHDTAQAVNTMHH
TAQQAAQEGYGSINPFVKSLFSSKAIATQAHPRHEETIVAAQQAVKPMRAPSMRRKGTVR
RGKRAGDTEGRMEGIEEAEGDEEGGATGVVSPFGGGEKDLTRSHTRAESQANNQNKDTPC
VAGEFRAALDTLFATLDETQPWFVFCINPNDSQLPNQLEGRSVKGQVRSCGMGGVARRNL
VYWEVNMTFGEFEERYAGVLEEVGVTPSSGEGVFGGSEESGSGRDKERALAEAFRALVVT
NVGGDFKDVVLGKTKVWLSQRAFRALEDRLRIKEGGERVGRELGMAGAAYESSTVHGHGG
QEGGGLDPYSPYRQAGEDGFYNSGQDLGTPGWNAGGYDQYNGSNQRLPLVSNASPFNRGE
SYDDEGAWRAGGKSDEEYEPPSRIRGDETDSMSNFGSESYAPSRNMFAGGDKGGGKKGGG
EKAALAGELLAADPNSGVAAPGETTEVLKESSARRRWVAFTWLLTWWIPSPFLVWFGRMK
RMDVRQAWREKLALNLIIWFICGCTVFVIAVLGPVICPTEHVYSTTELSDHSFDKSPNKV
YTAIRGEVFDLTKIAAMHQRKIPVVAPKEILKYGGREINDLFPVQVSALCDGIDGNVSPY
VMLSSRNVTDTNAVYHDFRASTNDPRPDWYFQQMVTMRYTARVGFRGYTPKEIRNMANRG
QSVAIYNGLVYDLTEYISTPPRAGSPEGTNPPPVNTQFMDGAVLELFTIHAGKDVTKELD
ELDIPRAVLRRQKTCLRNLFTIGKVDNRQSPQCLFSTYILLVLSIIMVSIIGFKFLASLN
FGAARAPEDHDKFVICQVPCYTEGDQSLRRTIDSLAQLKYDDKRKLLLIICDGMIVGSGN
DRPTPRIVLDILGADPNLDPEPLSFVSLGEGAKQHNMGKVYSGLYECSGHVVPYLVVVKV
GKPTERSRPGNRGKRDSQMLLMHFLNKVHFNSPMNPLELEMYHQIKNVIGVNPSFYEYLF
MVDADTTVEPLSLNRLISAMIHDKKLLGVCGETSLANAKQSIVTMMQVYEYFLSHHMAKA
FESLFGSVTCLPGCFTLYRLRTPDTHKPLLISNQLIHDYSENRVDTLHMKNLLHLGEDRY
LTTLLLKHFPRHKTQFVRDAHAFTVAPDDWKVLLSQRRRWINSTVHNLGELVFLDQLCGF
CCFSMRFVVMIDLLSTITQPVTVAYIAYLIYLIAGQGKPIPLLSLIMIAAIYGIQALVFI
LRRKWDMIGWMIFYILAIPAFSFFLPLYSFWKMDDFSWGQTRVVLGESGKKVIVHDEGKF
DPRAIPTKSWSDYENELWDKESNHSIGSWAPGKAGMGGGYAESRTASLYGRETLYEPQLP
QMRSFSPVPSQLGMHMMSANASGGFGAPPAYGSASGRNTPQSMYGGGSPGVFAPAPSRPV
TNYLDMPISGGFDSGFGGGLNAQHTGGGGMGGGPSDMELESAVQDVLRHADLNLVTKREV
RRTLEERFGMDLTSRKATINAAIDRILSSS

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	1429	1936	1.2e-236	0.9962049335863378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276845	MYSc_Myo17	0.0	52	928	1	647	class XVII myosin, motor domain. This fungal myosin which is also known as chitin synthase uses its motor domain to tether its vesicular cargo to peripheral actin. It works in opposition to dynein, contributing to the retention of Mcs1 vesicles at the site of cell growth and increasing vesicle fusion necessary for polarized growth. Class 17 myosins consist of a N-terminal myosin motor domain with Cyt-b5, chitin synthase 2, and a DEK_C domains at it C-terminus. The chitin synthase region contains several transmembrane domains by which myosin 17 is thought to bind secretory vesicles. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
367353	Chitin_synth_2	0.0	1428	1936	1	527	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
276950	MYSc	4.17e-154	55	919	1	633	Myosin motor domain superfamily. Myosin motor domain. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
214580	MYSc	1.13e-148	38	931	5	677	Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
395017	Myosin_head	4.23e-116	41	857	1	632	Myosin head (motor domain).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZQ26801.1|GT2	0.0	38	2127	12	1906
QDK64613.1|GT2	0.0	38	2127	12	1906
CCA72950.1|GT2	0.0	51	2129	15	1905
QRV98874.1|GT2	0.0	38	2125	11	1905
QRW25802.1|GT2	0.0	58	2111	23	1885

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I0H_A	3.57e-66	50	929	72	737	Crystal structure of myosin X motor domain in pre-powerstroke state [Homo sapiens],5I0H_B Crystal structure of myosin X motor domain in pre-powerstroke state [Homo sapiens]
5I0I_A	8.31e-66	50	929	70	735	Crystal structure of myosin X motor domain with 2IQ motifs in pre-powerstroke state [Homo sapiens],5I0I_B Crystal structure of myosin X motor domain with 2IQ motifs in pre-powerstroke state [Homo sapiens]
5KG8_A	1.13e-65	50	929	70	735	Rigor myosin X co-complexed with an actin filament [Homo sapiens]
7R91_D	2.02e-64	52	665	13	531	Chain D, Isoform 3 of Unconventional myosin-XV [Mus musculus],7RB8_D Chain D, Isoform 3 of Unconventional myosin-XV [Mus musculus]
7RB9_D	1.63e-63	52	665	13	531	Chain D, Isoform 3 of Unconventional myosin-XV [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VNT4|CHS5_CRYNH	0.0	47	2128	16	1930	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|Q4P9K9|CHS8_USTMA	0.0	35	2130	1	2005	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|O13395|CHS6_USTMA	7.71e-289	1101	1975	57	930	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VF17|CHS4_CRYNH	9.97e-282	1105	1945	154	1000	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	2.48e-143	1117	1941	83	958	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
1117	1139
1152	1174
1414	1436
1813	1835
1839	1861
1868	1890