CAZyme Information: CC1G_11067-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_11067-t26_1-p1
• CAZy Family: GH9
• CAZyme Description: alpha-mannosidase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		61519.65	4.5208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:1570473-1572984(-)

Full Sequence      

MISRKISLSLLLALSASPRLALGGFIQYAELARNVPLTAPHYRDMVRQVFIDGYSVYQQY
ALGHDVVNPVSQDFSDDRNGWGATIIDSLSTMYVMGLENLFHEGVQYASALDFSQSKTPD
TVNVFETSIRYLGGLLSAYELSGRQYPALLAQAQILADKMVFAWANGSDIPCSQIDFHGN
VPKQGVSNIAEAGTLTLEWGMLSKYTGNDTYRLLAERSALHIANMGAPLPGLPAQGIDPS
TGSSVGSYVTWGGGSDSYFEYLIKYPRFNFDASNVFADSWRAAVDTSISTLLRYSTYGNW
TYLADYDPSGTESIRHVGSHLACFHGGNWILGGRLLDNDTIVNYGLQLTDACWNTYASTS
TGIGPELWAFTSSDGSYTGSGSNLTLTESTFNAKNGFYITQPNYMMRPEVLESNFYAWRV
TGDTKYFGRAVTALQSFIDYLTVSGNETMGYTGLQDVMDEGVRGSLSDGRIDKTESFWFA
EVLKYLYLTFDDPANYNLDDYVFNTEAHLFRTPTANWDTVYGSGKPYYPNAPFTTTKGAL
PQVSGIPGLVSTALGLLNVGA

Enzyme Prediction     

No EC number prediction in CC1G_11067-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	50	511	4e-119	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.12e-147	49	511	1	452	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.48e-99	43	508	73	514	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP00856.1|GH47	5.42e-170	34	550	33	505
QRW13417.1|GH47	1.39e-167	26	549	20	521
QRV84818.1|GH47	2.47e-165	3	549	2	520
QRV98862.1|GH47	2.47e-165	3	549	2	520
QRW21492.1|GH47	2.30e-162	34	549	25	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HCU_A	5.54e-89	28	510	1	490	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
2RI8_A	8.83e-82	44	508	7	469	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.17e-81	33	508	31	504	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KKB_A	1.26e-51	43	510	23	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.52e-51	43	510	21	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12563|MNS1B_ASPPH	2.46e-93	6	511	6	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|Q0D076|MNS1B_ASPTN	4.23e-93	6	511	6	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	8.13e-91	44	511	44	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|A1CP08|MNS1B_ASPCL	5.95e-90	46	511	39	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q5BF93|MNS1B_EMENI	1.08e-88	44	514	35	503	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001977	0.998005	CS pos: 23-24. Pr: 0.7099

TMHMM  Annotations     

There is no transmembrane helices in CC1G_11067-t26_1-p1.