CAZyme Information: CC1G_10935-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_10935-t26_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	AACS02000004|CGC13	40434.49	6.0411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:1600990-1602406(+)

Full Sequence      

MMLSRPFLYLLTLALASNAFKSHILQARHQHNVVALQARCAPGPHRSPAESLEVPPSIPD
DPTESSPSSDRTVTIASDNAPLSDGGVGDDDGGDGDGEPSSGEGPSDPSGSLVEDRDSDP
LISAKSVASLTPNGIKAGIAGGDAYPYLKDHIGWWYDWSPNPSKPGRPIAVPMLWGGGTA
DAQDAARLAAFKKIKNVPRYVLGFEEPDCPPGSGSAGMSVDAAVSKWEAYIAPMKQKGAL
LVSPSMCKQADETWLAEFQKKIRTPWDITAIHVNKNNLAGVKKDIDHYLRYGKPIWVTEF
ACVNDNPNFVPCTNQAEIDRFINEIVPYLERHPKVYAYAYSNGLGLGNKWPLTTPGDNKL
TPSGRTYLAAISKFH

Enzyme Prediction     

No EC number prediction in CC1G_10935-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	149	367	2.3e-51	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.45e-53	151	367	17	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT06237.1|GH128	4.26e-88	130	375	22	270
PNP47955.1|GH128	5.73e-87	130	375	6	254
UKZ69748.1|GH128	2.30e-86	130	375	6	254
CEF87921.1|GH128	2.97e-86	122	375	29	283
CZS85595.1|GH128	1.69e-85	122	375	29	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	1.77e-92	126	375	193	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	4.36e-88	130	375	28	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAX_A	5.56e-22	132	370	91	345	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAW_A	1.81e-14	130	369	21	277	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]
6UAV_A	1.83e-14	135	369	4	255	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	2.41e-14	147	369	313	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.093825	0.906146	CS pos: 19-20. Pr: 0.8039

TMHMM  Annotations     

There is no transmembrane helices in CC1G_10935-t26_1-p1.