CAZyme Information: CC1G_10674-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_10674-t26_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	AACS02000002|CGC5	31368.61	4.2337

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:324180-325329(-)

Full Sequence      

MENEKPCSRVRPRSPSDEDNESRDPKIPRLTPKRDPALLYYRQSALCEEPLCIDAVKKIM
VLGDSYSANTRDSWVGFLVERIPSASRPSVDNFARPGATAEHDLDTQVKRLFGKTPSASS
VDGESLIVAWFGINDCGTTDDADDLEQIVERIFDALHDLYVKWKGKNFLLIDVPPMHRSP
GGVDVGMDDERYIAWNEAFLSQAKEFAETAANASTYVVSAYRIIGDILDNPEAHGLLQDT
IESLSEYDSDASEEEEKSEDEGDDESNPGSSAGRKEKDGKVAM

Enzyme Prediction     

No EC number prediction in CC1G_10674-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	120	246	1.1e-16	0.49063670411985016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	6.33e-18	58	236	1	221	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
404371	Lipase_GDSL_2	3.37e-11	61	241	1	167	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	9.55e-09	59	224	1	193	GDSL-like Lipase/Acylhydrolase.
238141	SGNH_hydrolase	7.24e-07	59	207	1	146	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238874	FeeA_FeeB_like	0.001	58	180	4	121	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA77953.1|CE16	1.85e-17	73	235	7	169
BCS06955.1|CE16	2.09e-10	73	235	13	194
BCR94351.1|CE16	4.03e-10	73	235	85	266
QRW11544.1|CE16	3.70e-09	73	240	77	243
QRV82804.1|CE16	3.70e-09	73	240	77	243

PDB Hits     

CC1G_10674-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_10674-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_10674-t26_1-p1.