CAZyme Information: CC1G_10603-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_10603-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: G-X-X-X-Q-X-W domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31717.71	7.9124

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000011:118959-120175(+)

Full Sequence      

MRLSALYLALHSSALTLAASLLETRQTTPLTQYIVENQCPSAINLFIAGQLDSSIPSQGN
TTKFLPANAGFFYTDANGGNSNGLRTLRAGFYGEQFYYYMVKDPDYVNVGMNVAPQGVPS
RQGYCVSVGCSDVNCPTAFSSPPTRFPPSGSTAPNPPFYQCPIANTTYRITFCPGGQWPG
PETWRIHPGFNTAKCLDVRGAVFSNGTPVQIYDCNGTAAQNWILNRGATSIRLNGTNFCL
DAGSNPANGVGMKIWQCYDNLPAQQWFYRDDNRITLQNQGRSSIILICGVAP

Enzyme Prediction     

No EC number prediction in CC1G_10603-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	176	276	1.8e-17	0.5053191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	2.97e-17	185	281	2	95	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.14e-15	189	273	7	89	Ricin-type beta-trefoil lectin domain.
214672	RICIN	6.69e-13	191	280	5	88	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
395527	Ricin_B_lectin	1.22e-12	194	266	55	126	Ricin-type beta-trefoil lectin domain.
411518	lectin_1	3.58e-11	175	266	700	791	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	2.28e-36	186	279	37	131
AGV14186.1|CBM13	9.54e-26	182	281	32	133
AUB23598.1|CBM13	9.54e-26	182	281	32	133
AFR93997.1|CBM13	9.54e-26	182	281	32	133
UOH83865.1|CBM13	1.11e-25	182	281	32	133

PDB Hits     

CC1G_10603-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_10603-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000343	0.999636	CS pos: 25-26. Pr: 0.6370

TMHMM  Annotations     

There is no transmembrane helices in CC1G_10603-t26_1-p1.