CAZyme Information: CC1G_10077-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_10077-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	AACS02000002|CGC14	88828.58	5.3474

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:417647-420172(-)

Full Sequence      

MALNEGVYWIRNSRFTNKVLDLDAANVAKGTSILDFNEHGTFNENHNQLWIVERFQSRDT
YLIRSVHSNLVLDLSQGLSANGTPILCWTQHGGTNQQWRIEWVKDDNKTPLYRIVSVATG
TAISHNEDDSSAYTVAWSVDDGPKQLWSFDPFVTPLLYRLRVKSTSRVLDLAAASADNGT
LALAWEQHTAITKRNQLWWLPYRSGAEEYTIQCLETSTVADLSGGNSGNGTPIYGWQSHG
GRNQQWKFEPTSDSGDYYHIKNVEGGSVMDAYMNDSQKRVGGWSNNGGDNQKWLLDPLPS
PGPGWVLIQNGGTGKFLCSTPSGDIGTADGPETVYDYSVQWRFIQREYTGVYHVVNRATG
AYLRQIGTSMPSIGLAEENDDELKDWWMLETYDNSEIGLASIISRWTGNVLDHYGGVSVQ
ALDNNTENSYRSWAIIPARDWLTSFSLVNGQGGLCLAAQYAREETRLSTTANVNDFHAQW
VFRKPSGSSGYTIQNKYNNHYVGGTSARWELVVCCNKYFGIRNTSTQKYLAIEDGQVTFQ
DQDMTDRKQCWELCSGRATDTSGNDYDLIYMDDDLLEVMIPWVGDKQGDLKHYIEKRATK
KPPKDKGGWQLPAAGLIKKPKFNDIRQLLQELIEQWEWDVVNEEREQIQTLVSIDEAEAR
RLLGRRPHPDIVAAYQRSRSSTLFRIDRQGYFNIAGDRYVNIQGQYGDDSYFHIALPVGV
RFGREQIRRFLRDSLDRSTSVTITPTTCKPPSGGPDYNRDPDSDGDNSWIKWTIAVVGTS
AIKHSEL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	111	249	2.6e-16	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404972	RicinB_lectin_2	2.53e-13	94	185	1	89	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	8.82e-13	47	123	2	73	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	1.43e-11	2	88	9	89	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	1.83e-11	194	293	1	89	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	8.29e-11	242	317	1	73	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI25034.1|CBM13	8.08e-71	5	782	11	815
AJW76687.1|CBM13	1.62e-15	4	247	283	515
AXY11218.1|CBM13	1.45e-13	4	251	283	519
QDF27401.1|CBM13	1.45e-13	4	251	283	519
QUG99081.1|CBM13	1.45e-13	4	251	283	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PHZ_A	2.12e-08	6	149	7	146	Chain A, Ricin B-related lectin [Cerioporus squamosus],3PHZ_B Chain B, Ricin B-related lectin [Cerioporus squamosus],5MUA_A Chain A, Ricin B-related lectin [Cerioporus squamosus],5MUA_B Chain B, Ricin B-related lectin [Cerioporus squamosus]
4G9M_A	5.48e-08	60	150	9	96	Crystal structure of the Rhizoctonia solani agglutinin [Rhizoctonia solani],4G9M_B Crystal structure of the Rhizoctonia solani agglutinin [Rhizoctonia solani],4G9N_A Crystal structure of the Rhizoctonia solani agglutinin in complex with N'-acetyl-galactosamine [Rhizoctonia solani],4G9N_B Crystal structure of the Rhizoctonia solani agglutinin in complex with N'-acetyl-galactosamine [Rhizoctonia solani]
2VSA_A	7.69e-07	8	263	465	705	Structure and mode of action of a mosquitocidal holotoxin [Lysinibacillus sphaericus],2VSE_A Structure and mode of action of a mosquitocidal holotoxin [Lysinibacillus sphaericus],2VSE_B Structure and mode of action of a mosquitocidal holotoxin [Lysinibacillus sphaericus]
5MU9_A	9.55e-07	111	254	7	159	MOA-E-64 complex [Marasmius oreades]
6YH0_AAA	1.70e-06	111	254	7	159	Chain AAA, Agglutinin [Marasmius oreades]

Swiss-Prot Hits     

CC1G_10077-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_10077-t26_1-p1.