CAZyme Information: CC1G_09535-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_09535-t26_1-p1
• CAZy Family: GH51
• CAZyme Description: cellulose binding iron reductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624	AACS02000006|CGC4	67371.52	5.9300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1297323-1300218(+)

Full Sequence      

MVLLVSTVLTLVFNVLLASAQATRWCDDLTSVCFQRYYEEHLDTAWGYLFPPTDRGEFVG
FFIAPVRSGWIGNSLGGSMRGNPLVVGWLDDDNKPVISARITPCNCTTWTGGSGGINLNG
THLFGYATHAAIKPIDPSNPNSSLYQHTEASLHTLDTVAGRSDAYDTDLGQLTNAPPLVP
PTPTTTTTGTGPTPTEPALCPGAPRPTYPLYVASGWKVTPVLGRLAGAPRQIMVDSRGNL
LVLQRDIGVTGHTVDENGMFNPFHITRSIHVSRKFPDYISLSVGSDGNLDIPSMDPALGR
SQIRVFDMRHLAAHANRYNGTHGKVFGYGLRNDVGIAEDRAGNVFSVENSLDDAHRVIEG
VRVDIHDDNPAEKIYRLGKPTSPNQRFFGGYPYCYSVWEEKDIPNANLKPGQYFVQDPNG
PYSDAWCNINAEKPVAILPPHAAPLDIKFGVHQDDGNLYVALHGSSARTETLGYKVVAIP
GSYSPSGEWTSDLDLVGTKTGTIDIFFNEDETKCRSGCFRPCGMSFAPNGNLYVSSDTSG
EVFLLKPPFQGPPVIPTTSLPQIPSTTSSGPQATQTIYGQCGGTGYSGPTVCAGGSRCKQ
VNPHFSQCLPLGAWWRDKEGGGEE

Enzyme Prediction     

EC	1.-.-.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	257	545	2.7e-82	0.7057356608478803

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	9.34e-28	25	163	1	176	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	2.18e-26	25	156	2	167	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
197593	fCBD	4.71e-11	578	609	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	9.14e-10	578	603	2	27	Fungal cellulose binding domain.
225044	YliI	1.30e-04	320	544	228	392	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAU83856.1|AA12|AA8|CBM1	3.12e-188	15	610	13	725
BAP91034.1|AA12|AA8|CBM1|1.-.-.-	3.12e-188	15	610	13	725
QRC98168.1|AA12|AA8	3.97e-75	26	545	30	651
CAE7000862.1|AA12|AA8	4.05e-67	21	545	24	648
CBX95260.1|AA12|AA8	2.91e-66	20	545	23	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JT5_A	1.42e-123	200	546	5	409	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
6I1Q_A	2.23e-50	207	546	7	401	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	2.28e-50	207	546	8	402	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	2.34e-50	207	546	9	403	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT6_A	2.87e-44	23	178	5	195	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P8P3|GUX1_TRIHA	1.83e-11	552	609	450	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1
sp|P19355|GUX1_HYPRU	2.47e-11	557	609	462	514	Exoglucanase 1 OS=Hypocrea rufa OX=5547 GN=cbh1 PE=3 SV=2
sp|P62695|GUX1_TRIKO	5.71e-11	557	609	461	513	Exoglucanase 1 OS=Trichoderma koningii OX=97093 GN=cbh1 PE=3 SV=1
sp|P62694|GUX1_HYPJE	5.71e-11	557	609	461	513	Exoglucanase 1 OS=Hypocrea jecorina OX=51453 GN=cbh1 PE=1 SV=1
sp|A0A024RXP8|GUX1_HYPJR	5.72e-11	557	609	462	514	Exoglucanase 1 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=cbh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999706	CS pos: 20-21. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in CC1G_09535-t26_1-p1.