CAZyme Information: CC1G_09524-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_09524-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		77600.39	7.9196

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1270643-1273535(-)

Full Sequence      

MFSSLFWAIGLLSVLVHGQVASQWYDSLTGVTWQRYYQQDFDASWGYLFPSSAGGAATDE
FIGIFQAPANSGWIGNSLGGGMRNAPLIVGWVDGTTPRISARWATDYAPPSIYSGPRLTI
LGSSGSNGQIQRIVYRCQNCTSWSGGGIPSTGSSVLGWAFHATLQPLTPSDPNSGLYRHS
AAGQHGFDLGTRTSSYNYFLQQLTNAPPLSGGAPTQPPTSQPPTPTTPPPQPPPSSTFVS
CPGAPNPRYPINVVSGWRAVPVLGSLSEPRGITMDTRGNLLVLQRGRGLSGHTLDANGCV
TSSKMVIQDSAINHGVDVHPAGNRIIASSGDIAWSWDYDPVTMTTSNKRTLVTGMNNNFH
FTRTILISKKNPNIFAINVGSASNIDEPTRQPGSGRAQIRVFDYNNLPASGTTFTSSYGR
VLGYGLRNDVGIAQDRAGNFWSIENSLDDAYRMINGQRRDIHINNPAEKVYNLGDPANPR
SLFGGYPDCYTIWEPADFNDSTKRVGDWFTQTNSGQYNDAYCNSNTTAKPVVLLPPHTAP
LDFKFGVGNDSNLYVPLHGSWNRQPPQGYKVVIVPGRWSASGEWSPTVSLAETKNSWSTL
ISNVDETRCSGFGNANCFRPVGLVFSPDGQNLYVTSDSSGEVILVKRLSGPTNPGQPPTI
TTQPGTPTSQPPVQPPTTIAPPQATQTMYGQCGGQGWTGPTLCPANAVCRASNQWYSQCV
PA

Enzyme Prediction     

EC	1.1.99.18:3	1.-.-.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	240	643	9.7e-132	0.9925187032418953
AA8	24	193	1.8e-41	0.9560439560439561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	1.68e-53	24	195	1	176	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	9.61e-47	23	189	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
395595	CBM_1	1.38e-10	688	716	1	29	Fungal cellulose binding domain.
197593	fCBD	2.20e-10	689	720	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
225044	YliI	2.66e-06	199	644	26	392	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAU83856.1|AA12|AA8|CBM1	0.0	3	722	4	726
BAP91034.1|AA12|AA8|CBM1|1.-.-.-	0.0	3	722	4	726
CAE7000862.1|AA12|AA8	9.90e-123	25	647	29	650
QRC98168.1|AA12|AA8	5.02e-120	26	639	31	643
CBX95260.1|AA12|AA8	1.81e-119	13	639	16	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JT5_A	1.89e-242	237	647	1	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
6JT6_A	8.73e-109	22	211	5	197	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
6I1Q_A	3.10e-66	249	647	8	402	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	3.18e-66	249	647	9	403	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	3.27e-66	249	647	10	404	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	4.27e-28	15	220	15	223	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|P43317|GUN5_HYPJE	1.48e-11	686	721	207	242	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|Q5B2E8|CBHC_EMENI	6.18e-11	683	722	18	57	1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhC PE=1 SV=2
sp|Q99034|AXE1_HYPJE	1.42e-09	682	720	264	302	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|B0XWL3|CBHC_ASPFC	3.12e-09	683	721	18	56	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999727	CS pos: 22-23. Pr: 0.5680

TMHMM  Annotations     

There is no transmembrane helices in CC1G_09524-t26_1-p1.