CAZyme Information: CC1G_09521-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_09521-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	AACS02000006|CGC1	49872.22	4.2910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1263051-1264951(+)

Full Sequence      

MRKSTGSTTRSSLTFLLLLPLFSFFCFQQASAQTSYANEFIDPDLILAGDFANNTAAAQR
MIRNWASKWASEGPWSVMLKDATPPSGTKHDYMSWAPYWWPDCSDVGNTTVLSEEEVWTT
CPYRRRDGEFNPDVRGVNDVGNFQDMSDAVLYNALAWSLEEAGKTLTWFLNPDTRMNPNL
NFAQMIRGSNGRPGSATGVLDLKGMAKIASAILIFRKGGSTEWTSDDDEQMVEWSREYIE
WLETAELALDEGNSRNNHGSFYYNQLAALKLIVDDIPGAINVSSTYFSRQFQSQIAADGE
QTNARIWKYADPSSNVWEITSAEGATIKTALDYAMTHSASSSGESQYAAELYPIVAAVAS
VYGDPDGQYLNFLQENDEGFYAEPYFLWNSGEWTSDVTSTARPGGPKPTSRKTQGSPSVD
EDAGSADGRGVRLWGLALNVAVLAHTLLSVVI

Enzyme Prediction     

No EC number prediction in CC1G_09521-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	77	303	4.9e-61	0.7813620071684588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	5.77e-36	80	339	6	269	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV83646.1|PL38	6.97e-123	31	448	21	462
QRW05956.1|PL38	1.39e-122	31	448	21	462
QRW12314.1|PL38	1.39e-122	31	448	21	462
QRV97757.1|PL38	7.19e-120	31	448	21	462
QRW24462.1|PL38	2.78e-117	34	416	23	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	4.49e-25	57	301	29	265	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

CC1G_09521-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000486	0.999472	CS pos: 32-33. Pr: 0.9687

TMHMM  Annotations     

Start	End
13	32