CAZyme Information: CC1G_09518-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_09518-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: cellobiose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665		71636.10	4.5844

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1255985-1258848(-)

Full Sequence      

MGDRAISTYAQDRPGTSEWCDSITDICFQRYYDADLDIAWGYVFPPSPSAGEPQPDEFIG
LFTGPVSAGWIGNSLGGGMRSNPLVVGWVDNEHNALLSVRFTSRFASPDPLEGPQLTLLG
TSGANATHQRIVYRCQNCTVWEGGSNGIRFNETAQFGFAAHGSQKPDDVANADSSVPVHS
VAGQHDFDVSSARSDSYDMALQQLQAAPPLRPPIEEDAPSPSTPAERPTGSNPSACANAP
QASHAFKTGPGWVGTPVLGGLRTPRGIILDGRGNLLVIERGKGLTGHTLDSEGCVTNSKL
IIDDTRLNHGIDVVGNRLVASSSDIAWAWDYNDSEMTVSNRRVLVTGMDNPGHVTRTLHI
SRKNPDYLVVSVGSDGNIDEASIQAESGTAQIRVFDMRTLPEDGAAYTDETYGKVLGYGL
RNDVGITEDKAGNIHSIENSLDNAYRVVNGDQRDIHTDNPAEKVYNQPAGIFGGYPICYT
VWEEKDFRDGDTRKKPGDWFVQDPGNSTFNDEWCEANAVKPTVLLPPHTAPLDLKFGVKS
GDSNLYASLHGSWNRQPPQGYKVVAVPGQFSSSGDWSPSGSLKDTKTSAVDILANLDEND
CQRGCFRPVGLVFGNDGEHLYVSSDTTGEIFLLRPGDNSGGAKTLSQTSVTFSLFLSVFI
GIWLA

Enzyme Prediction     

EC	1.1.99.18:3	1.-.-.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	236	633	2.7e-127	0.9950124688279302
AA8	19	198	2.1e-39	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	3.36e-54	19	196	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	5.57e-45	19	189	2	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
225044	YliI	1.56e-15	199	574	22	365	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
226417	NosR	0.002	5	84	193	276	Regulator of nitric oxide reductase transcription [Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAU83856.1|AA12|AA8|CBM1	2.65e-250	10	634	18	648
BAP91034.1|AA12|AA8|CBM1|1.-.-.-	2.65e-250	10	634	18	648
QRC98168.1|AA12|AA8	4.50e-122	5	633	12	651
CAE7000862.1|AA12|AA8	4.23e-110	10	633	19	648
CBX95260.1|AA12|AA8	5.94e-110	7	633	16	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JT5_A	5.77e-185	236	634	5	409	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
6I1Q_A	1.11e-66	251	634	16	401	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.14e-66	251	634	17	402	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.17e-66	251	634	18	403	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT6_A	1.15e-61	17	210	5	195	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	2.36e-18	17	288	22	273	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q44091|SNDH_GLULI	6.17e-15	290	625	145	433	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995967	0.004057

TMHMM  Annotations     

There is no transmembrane helices in CC1G_09518-t26_1-p1.