CAZyme Information: CC1G_09442-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_09442-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1007	AACS02000010|CGC2	112214.47	5.0514

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:729365-733101(-)

Full Sequence      

MSRLPFVLTALLFAQNVLAIGQPSCVSSRSSSGSFAVVANGRRAAPIFTSEEDWPGVHIA
AADFAADIRRVTDVNPSLRNGTVSDLSGSRPIIVGTLGKSALIDAIVNSNSTGLDVSSIE
GKWESFIGKVVENPLPGVQSAYVIVGSDKRGTIYGLYEHSEQFGVSPWYWWADVPTTKRP
QIHLTAEGCSHGEPTVKYRGIFLNDEQPALQNWAFEKFTNGTGSEHFNSPFNRFFYTRLF
ELILRLRGNYLWPAMWGSAFAMDDPLNQFLADRYGVVMGTSHQEPMLRSTPNEFTIVGSG
GWDYVGNTEAIQKYWREGVERGKDFESIYTMGMRGFGDLPLSEETNIELLEKVIEDQSAI
FREVYGEDVDLATIPQVWTLSDYSKDKEVEGYYDKGMRVPDYITLLWADDNWGNIRRFPT
PSERNRTGGAGVYYHFDYVGDPRSYKWLTTTQLEKVHEQMSLAVDREATRLWIVNVGDMK
PFEREIEFFLSYGYDAPRWKHNNINEFVNLWAQREFDVDQNTAEAITGIVGNLTRYNARR
KPELLNGTTFSLINYREADNVLTGWDNLVSASTRIYNRLSNAFKPAYFQLVHHPVIASAN
LGHMLINVGLNNLRASQASQSANTYAAIAERLFDRDWEIETEYHKLLDGKWNHFMSQTHI
GYYYWQQPMANTLPGLVKVATRKQALPGVMRITAENSNGAWPGDNRNNCRDGYNCGDPTL
TIDNYDTFGNKYIDISAGGPSSFDYSIKSSESWVRISSTRGSISQKNKDIERVFFSVSDW
GSLQDGRNEARITVTANARGQNPLDVNVNFVAIKNAVQGDFKGFVEGAGVISIEAAHASR
NSSVGNYAWQELPGYGRTLSAVTPLPRTDDSYEAGTGPTLEYDFYNFNAVGDEHNVTVTV
LLAPAFNFATESNPLAFGLTIDDQPIQRIQPIPPLSKPGDFPPGWGGEFGWVANSITPYV
ITFSNVAPGAHTLKLSAIESGVVVQKIIIDAGGLLTSYLGPPESIRV

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	38	680	2e-236	0.8479196556671449

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	0.0	192	544	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	2.67e-68	823	1003	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT97380.1|GH115	0.0	6	1007	8	999
ADV52250.1|GH115|3.2.1.131	0.0	10	1007	10	987
QRV92865.1|GH115	0.0	3	1007	2	997
QRV78071.1|GH115	0.0	3	1007	2	1000
QRW20553.1|GH115	0.0	17	1007	45	1021

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	9.57e-229	21	1006	1	935	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	6.95e-151	47	688	28	659	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	7.81e-150	35	688	44	674	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	2.14e-148	47	688	27	658	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	9.47e-138	48	1007	23	966	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

CC1G_09442-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000316	0.999652	CS pos: 19-20. Pr: 0.9731

TMHMM  Annotations     

There is no transmembrane helices in CC1G_09442-t26_1-p1.