CAZyme Information: CC1G_09291-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_09291-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		55293.21	5.6780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000003:3588784-3590761(+)

Full Sequence      

MVQLLTPDGVFLLSMLSILSSYCWPDALAATSDGLTNDLAGKGFDVVFPTDERFVNVSQA
FNRRYTPNPAAVAFPSTAQQVSQIVKVGYERGYNVVARSGGHSYAAHGLGIHPNAIVVDL
SSIKTLSVDTDKNTAVIGAGNRLGEVVLGLNKYGRALPHGTCAYVGWGGHATLGGYGFTS
RMWGLSVDTVESMEVVLANGTLVSTSEKWYPELFWATPYLGIVVSTTVRTFAVPPSATIF
SVSYPNLGISQATTALLHYQRWSRRPDIPKAIGLQAVLTRGSESGKVGFGFSGGWYAPVS
SDGLDLNRTLKPLVDGIGVEPTRVNFDSGDYVHSAENLAGGSLDTTQPGGRDTFYAKSLV
IPEDEGLREGTVREFVTVFATQGFETPLGWWFIQLDLFGGRDSAINDKRPEDTAFPHRRG
LWGIQLYASTRENVPPYPEGGFEFLDDAVNAILKNSPRPRNFGAYANYIDDRLGEGAPDL
YFKSNWKRILRVKEKYDPTGVFELPDGW

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	60	279	1.9e-65	0.4737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.95e-31	69	206	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.82e-30	62	502	25	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.18e-08	464	502	1	38	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215258	PLN02465	2.27e-08	75	229	103	259	L-galactono-1,4-lactone dehydrogenase
178402	PLN02805	1.05e-07	69	247	134	321	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA69005.1|AA7	2.14e-81	43	507	32	483
QRW27390.1|AA7	2.51e-81	46	507	43	489
RDX44700.1|AA7|1.1.3.-	1.13e-75	39	508	39	510
CDR44461.1|AA7	5.35e-75	20	507	19	512
QRW15212.1|AA7	7.66e-75	40	507	36	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	8.36e-64	61	507	53	491	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	1.04e-63	60	507	52	487	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3RJ8_A	1.91e-62	39	507	7	468	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	2.72e-62	60	502	34	470	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	5.48e-61	60	502	34	470	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	4.30e-63	61	507	53	491	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	5.36e-63	60	507	52	487	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	1.17e-61	26	507	17	490	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	1.28e-61	60	502	53	489	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	1.85e-49	61	507	55	488	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.262522	0.737442	CS pos: 29-30. Pr: 0.6643

TMHMM  Annotations     

There is no transmembrane helices in CC1G_09291-t26_1-p1.