CAZyme Information: CC1G_08727-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08727-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		67449.28	6.1848

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:920021-922758(-)

Full Sequence      

MPLIANPEEIANKTFDYVVVGAGTAGLTLATRLTEDENVSVLVLEAGIRHHGDPNIDVPA
QYGATFMQPKYDWAFKTVKQKHSNDNEHVWARGKGLGGSSNMNFFCWIKPPAEDVDAIEK
LGNPGWNWADYEAYSKKSETFHPAVPEIAEKYPHTYNAKFRGTSGPIQVTVPLHAHTLDE
IWQNTLANKGVRKIEDPYGGDITGTWIAANNVDPKTWKRSYSATAYWEPNQHRPNLHVIT
EAYVTRIVWADEKDSEGNLVATGVQFVHGSTERTVLASKEVVLSAGTVKTPQILELSGVG
KPEILSKFGIDTKLNLPGVGENVQEHHFMWVIYELDTTKGDHQTLDMFFEPGYVQESLKL
HAEGKGLHRTGITSFAFLPLSSRDPKAAAALIDELEADLKKKKESGEISPALAKQYDIQL
EILRNDKVPDMEFIVFPGYFMCPASQGTGRRFMTVISSLNHPISRGYIHIKSNNPLDDPE
IDANYFGHNFDLKVLLEHVKYIRSLEDTEPFKSHTIKEVVPGPECASDADIENHIKNSHI
TTFHTVGSASMLPREDGGVVDPKLKVYGTKNLRVADLSIVPLHIAAHMQATAYVIGEKAA
DLIKADAK

Enzyme Prediction     

No EC number prediction in CC1G_08727-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	606	2.3e-183	0.9982394366197183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.89e-101	11	608	4	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.65e-99	10	604	1	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.36e-39	462	599	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.20e-27	89	326	20	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.18e-23	14	596	55	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71929.1|AA3_2	2.26e-150	15	607	18	606
SJX61802.1|AA3_2	1.02e-148	15	607	18	606
CDS82146.1|AA3_2	3.63e-146	15	607	18	606
SAM80724.1|AA3_2	1.06e-145	15	608	18	606
CDI52576.1|AA3_2	3.56e-144	15	607	18	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.85e-94	14	608	5	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.84e-76	15	606	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.00e-75	15	606	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	5.33e-75	12	604	3	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	7.22e-73	3	605	5	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	4.24e-108	6	603	38	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.24e-108	6	603	38	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	1.67e-95	8	606	7	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.31e-94	9	606	8	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.31e-94	9	606	8	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999534	0.000511

TMHMM  Annotations     

There is no transmembrane helices in CC1G_08727-t26_1-p1.