CAZyme Information: CC1G_08725-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08725-t26_1-p1
• CAZy Family: GH44
• CAZyme Description: killer toxin resistant protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		68146.61	4.4345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:912603-915259(-)

Full Sequence      

MSYFGPKRARILSHASEKSSLLGGSGSSKNGNLSRPGSISSLHESIAERYSLAASPRSWG
TPLTMHQPEDDDELHNPSSIRDAMGDRGGAFFSWRGLSNLGCLVLLVAGILALFAGKGYP
LISYFVTKQEQTAQGGFNLGGINATGQIPEFIGNFGLIDRDTPLEAHTKRSYNNPDEELV
LVFSDEFNQDGRTFYPGDDPYWEAVDLWYWGTVNLEWYDPSQVTTEGGYLRIRLEEVEDR
SLNHNMTYKGGMLQSWNKFCFTGGLLEASVQLPGSNSVGGLWPALWAMGNLGRAGFGASL
EGLWPYSYDHCDVGTLHNQTYTFNRDLPVAATENGDPQYGGVLSFLPGQRLSACTCPGEA
HPGPVRSNGEYVGRAAPEIDVFEAIVEDGHAQISQSAQWAPFNAQYRSVNNARTIIIHEP
NSTEYNTYVGGAFQQTTSALVYTNPDCYEQSDPSCYSVYGFEYQPGFDEGYITWINDGRR
SWTLMGTSMVADNEVEIDHRPISLEPMVCRILTTRETLLDRAATKYIIANLGISPSFGEY
DPETIELPAVMSIDWIRVYQPKNAINIGCDPKEYPTAAYIERYKEAYTNANLTIWEDTGE
PWPKNRLTNPDGQCD

Enzyme Prediction     

No EC number prediction in CC1G_08725-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	185	559	8.3e-123	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	62	610	2	499	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.58e-141	181	560	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	1.23e-40	181	571	51	353	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.83e-19	183	559	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	7.61e-04	185	286	1	87	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV94223.1|GH16_2	2.41e-226	24	607	48	604
QRW08448.1|GH16_2	6.86e-226	24	607	48	604
QRV79586.1|GH16_2	6.86e-226	24	607	48	604
QRW19070.1|GH16_2	3.19e-225	44	607	63	598
QRV91234.1|GH16_2	1.53e-218	45	607	83	599

PDB Hits     

CC1G_08725-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	3.60e-112	62	614	210	711	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	1.54e-111	62	607	239	734	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P33336|SKN1_YEAST	1.38e-110	37	608	216	760	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13941|YEPB_SCHPO	9.85e-108	69	607	132	623	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87023|KRE6_CANAX	1.70e-106	31	607	197	737	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

Start	End
91	113