CAZyme Information: CC1G_08598-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08598-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: G-X-X-X-Q-X-W domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	AACS02000009|CGC2	33822.79	4.3721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:2094485-2095735(+)

Full Sequence      

MIRSGFFSALVSATLLAGSVHAQTYTVTNNCPTAIDLFIGQNSEGSLATGASIVKTGLGP
TAGFFYTTTNGGVVNGQLVAARAGFFLEPTYWYYYIVRDQNPNNFNTGISITPDKPVSDG
FCTVATCNFGNCTTAYNSPPVFHSPVPPPADAPAQNPPIYQCKEPDVNFLITFCPSGTWP
QAPGVEVKPNFNENKCLDVQGAVFANGTPVQVYDCNGTNAQKWVLSQGSTKVRVADTNFC
LDAGSTPGNGVPMKIWQCYDNLPAQQWFYTLDYRLALEGQGQCLDLTDGDLANGNVVQTW
QCSNGNNNQVWTLGV

Enzyme Prediction     

No EC number prediction in CC1G_08598-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	190	312	3e-23	0.6436170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	4.48e-24	190	311	7	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	8.41e-24	194	313	10	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	3.95e-20	192	313	5	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411519	lectin_2	6.79e-16	192	311	125	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	4.23e-14	229	313	2	84	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	3.70e-43	189	314	39	165
UOH83865.1|CBM13	1.00e-37	185	314	34	165
AGV14186.1|CBM13	1.08e-37	185	314	34	165
AUB23598.1|CBM13	1.08e-37	185	314	34	165
AFR93997.1|CBM13	1.08e-37	185	314	34	165

PDB Hits     

CC1G_08598-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_08598-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999696	CS pos: 22-23. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in CC1G_08598-t26_1-p1.