CAZyme Information: CC1G_08570-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08570-t26_1-p1
• CAZy Family: GH37
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1620		182344.23	4.8846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:2021937-2028035(-)

Full Sequence      

MKRGLQLLLAAAALSLSAADEIPQVEISLKTSWPAPPLMHEILESIALENPYEYFTFLDA
LTDPTAVPKNTELNPEDIYKAAIELGISRGFNLATGWIANLKANLALHSTSPKIEAFYNY
YTNYVNNTKGNECGSWVDWYGEVVCDVDTLTRLTAKDPIGDGKYPRPQSLSFDHIYPPPD
RVAEKPPRTAILYAQFASPNFRALHSHLYDLARQEDARVEYVLRYVPPPPSDKPREPNVL
SGYGVALDLKKMDYLALDDRFQQENSVAQHNGWGRPYDPVLDLIEAHPEKPDAPNATVPL
TEEELAGLGAQAIQVISEGYAPMEIFQQLAEDFPKYATSLARRVVANESIVEELKENSVK
AKGGVNMFWLNGALVENYDVEALPLLRMLRKERDLMLSLTRLGLSREQAFDVLTHPIISA
AHRDTSDALFDASDRQEGGDVVFYFNDIEKDSRYSNWAPSLHELIRPMYPGQFPNIKANL
FNVILALDLSQVTSLNFIAGPVSNIIERGMPFRFAVAPIIETEDGKKMARLFYYATKTFG
KKKTVELLRNGAVHDLQPDDPIPPVRWSAIEEGFNQIASALETEDPEKKILPFKQVLEGK
AMAEGLEDKIQAYHKRLDTTLATGPTGHAFFNGKHIVFDQTFLKHLREGGMEQQQFLMEQ
VYRGVLKDDILKEKGMGDYWYDLPKTNKRRNRYIFPTSHKDLKVVNLPDALHTKAEMSFG
AESFVYPKNAQIQTPIFTTFIVGDFESEAGLALAREALKLVESEKSQSRITFVPNPAEWA
AVKDESANALVSKLVTKKALKAASPSIVAKALNVDISSPVSSGDDKQVPLSSKVAITQLL
GSEPGEVDKKEVRRYLKRSRIFAREAGVKPGETAIIINGRVIGPIPVNDFSVSDFEALEE
YEAVKRTGPVLGALNAVAGSLNEDKDKFADAIYLASSIISWTQIPDPSQAGLFDAPPRPR
TRNYEQLNDTYTSFEFGDREYALYYLTFLVDPLSPTGQKWAGIMRWLSMSANVYIKVYLN
PDTYKEMPVKRFYRSCLEPQILFNFWSREDPAKVQFKGLPTDPIYTLSMDVPASWLVRPK
ESRYDLDNIQLTQLFPEDKSLKAVFSLDALILEGHARETATQTPPRGVQLQVVASDPSKE
EKAVPVQDTLVVANLGYFQFRLNPGVYGLEIREGNGRKIYDMESVGGLGWDSPGVDEVGN
QVALTDFEGVTLFPRLKRKPGMEKVDVLEEDKASSGVLENISTKVKSIFKGKETGVVPVK
EQAEINIFTVASGLLYERFASIMILSVLKNTKSTVKFWFIENFLSPSFLEFIPHFAKEYN
FDYELVTYRWPSWLRAQTEKQRIIWAYKILFLDVLFPMDLKKVIFVDADQIVRADLKELV
DLDLQGAPYGYTPMGDDNKEMEGFRFWKTGYWKDFLQGKPYHISALYVIDLVRFRHDILR
GQYQALSADPGSLANLDQDLPNNLQRQVPIFSLDEDWLWCETWCSKDRLHRAKTIDLCQN
PLTKEPKLSRARQIPEWEEYDAEIARFTRRLAEEGKISSGLSTADANVLAGASNTEPEEV
AKPEEVKPETKEESSPVPETKEEPAVPEKKEEPKETVEEEAAPSSATSVEAEAARPTDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1265	1508	1.2e-120	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1265	1527	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.46e-169	1265	1508	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	2.02e-74	430	694	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	8.97e-57	35	233	1	184	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	1.05e-56	1265	1508	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA74280.1|GT24	0.0	16	1556	18	1552
QRV90671.1|GT24	0.0	13	1550	13	1553
QRV75871.1|GT24	0.0	13	1550	13	1553
QRW18757.1|GT24	0.0	9	1550	10	1489
KGB74213.2|GT24	0.0	18	1544	16	1550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.02e-276	23	1534	9	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	3.98e-276	23	1534	9	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	3.98e-276	23	1534	9	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.86e-243	23	1470	2	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.60e-217	23	1534	9	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	2.28e-221	25	1525	22	1422	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.16e-206	28	1524	50	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	3.44e-206	2	1534	24	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.23e-203	4	1524	26	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	8.42e-203	29	1533	34	1513	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999768	CS pos: 19-20. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in CC1G_08570-t26_1-p1.