CAZyme Information: CC1G_08277-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08277-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: cellobiohydrolase II-I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		45613.86	4.4255

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:53185-54601(-)

Full Sequence      

MKYLNLLAALFTVAPLTLAAPSASFERRQDSSVNPYIGKSPLVIKTYGEKLEETVRYFEE
QGDELNAARTRTVQSVPTFAWISDSASIDSIKPLIADALAQQEATGEKVIVQIVIYNLPD
RDCSAKASDGEFHLDDDGFNKYKAYVLVADEWSPTGIAEELSTEDADKLHFAIILEPDSL
GNLVTNMHVEKCRGAEAAYKEGIAYTISSLQKPNIDLYLDAAHGGWLGWNDNLRPSAEVY
REVLDLAREITPGARVRGLATNVSNYNPYKTQAREPYTEWNNSYDEWNYVKNLVPHLEAV
GFPAHFIVDQGRSGKGGIRTSWSQWCNIRGAGFGIRPTSDPQVLDSENVDAIVWVKPGGE
SDGTSDVDAKRFDENCRSEVAHVPAPEAGQWFNDFVVNLVLNANPPLEPLEL

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	56	366	1.6e-84	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	5.60e-140	63	371	1	293	Glycosyl hydrolases family 6.
227616	CelA1	7.27e-47	17	407	10	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAH08705.1|GH6	1.78e-297	1	412	1	404
BAH08704.1|GH6|3.2.1.91	1.34e-246	1	409	1	400
BAH08703.1|GH6|3.2.1.91	4.53e-214	1	409	1	398
BAH08706.1|GH6	1.28e-199	1	409	1	397
CBX92025.1|GH6	4.93e-118	11	409	7	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A64_A	5.47e-238	20	409	1	381	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	9.05e-237	20	409	1	381	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	3.25e-113	31	407	5	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	5.25e-112	31	407	5	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
1BVW_A	5.82e-97	68	406	34	359	Cellobiohydrolase Ii (Cel6a) From Humicola Insolens [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	2.16e-108	6	405	35	409	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|P49075|GUX3_AGABI	2.00e-105	34	407	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|A2QYR9|CBHC_ASPNC	1.20e-91	22	405	88	457	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|Q9C1S9|GUX6_HUMIN	1.39e-91	68	406	150	475	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	1.99e-91	9	407	3	364	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999760	CS pos: 28-29. Pr: 0.7373

TMHMM  Annotations     

There is no transmembrane helices in CC1G_08277-t26_1-p1.