CAZyme Information: CC1G_08258-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08258-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: xylanase 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214	AACS02000002|CGC10	23358.99	6.7118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:14142-14886(-)

Full Sequence      

MNYSFVAFAGTLFTLALSAATPSNARSTSSNIGTPNSKDTGATANYTNEPGGKFTVNWWK
NGTFVGGKGWSPGSSDRVFNYIGIFEPSGYSLVTFYGWTRDPRVEYYIVESFGDYTPATD
TVRKGEATCNGATYEIGNTWRPDPDSPNFPIGSFQQIWAVRVPKKGVGKINGTIDFGCHV
RAWRALGMELGAHDWQIMAIDGYFSSGHATIEII

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	38	211	1.6e-46	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	3.94e-66	38	210	9	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR33049.1|GH11|3.2.1.8	3.63e-64	39	213	54	229
CDS82492.1|GH11	7.85e-60	44	213	55	225
CDS82534.1|GH11	2.32e-59	44	213	45	215
CDS82486.1|GH11	1.66e-55	1	213	2	232
CDS82538.1|GH11	2.08e-55	39	213	52	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H1A_A	1.76e-51	49	213	31	190	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
1XNK_A	2.05e-51	49	213	31	190	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
4XQD_A	1.34e-50	46	213	26	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
2JIC_A	1.38e-50	46	213	27	189	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]
1ENX_A	1.38e-50	46	213	27	189	Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1ENX_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],2DFB_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],2DFC_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],3AKP_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKP_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKQ_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKR_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKS_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3LGR_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4HKW_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2D_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2F_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2G_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2H_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],7MGU_A Chain A, Endo-1,4-beta-xylanase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P35809|XYNA_SCHCO	1.12e-55	44	213	25	196	Endo-1,4-beta-xylanase A OS=Schizophyllum commune OX=5334 GN=XYNA PE=1 SV=1
sp|Q92245|XYN4_MAGGR	1.87e-51	39	213	61	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea OX=148305 GN=XYL4 PE=3 SV=2
sp|G4NA54|XYN4_MAGO7	1.87e-51	39	213	61	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL4 PE=3 SV=1
sp|A6YAP7|XYN1_LEUGO	5.78e-51	39	213	57	233	Endo-1,4-beta-xylanase 1 OS=Leucoagaricus gongylophorus OX=79220 GN=Xyn1 PE=1 SV=1
sp|G0RUP7|XYN2_HYPJQ	1.90e-49	46	213	60	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=xyn2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999701	CS pos: 25-26. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in CC1G_08258-t26_1-p1.