CAZyme Information: CC1G_08066-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08066-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: macrofage activating glycoprotein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		46120.26	4.5635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:3044839-3046406(-)

Full Sequence      

MIKSLLATFVSLAAFSTIVEAQLPEYTGELLLRPSINDNKCLTASALHDGAPVVISTCTG
AASQKWVFTGNNGLVQTANNMCLDVTDGVNADGTKLQVWTCSPGNPNQNWWYDKWSNTLS
WTDRWRCLDVTDGIQDDGNQVQVWGCWDKNPNQIWSTGYMPNALPYQSQNGQYGTNQCGG
GNDQNSNCQTSWINSATDFCLWGPPWHGPVGNTERVAVAYCTKNGRGTRSIPDGTLTGVH
FVRTPEYVQITGTGDFTNLNIPAGDDGGELDNKGADGKGNPIGGLLFGNTFVNGLQYNEW
TQFISDREFCIRACIGPRAKQLCNHIYDVMGCWWNMPANYNSGVFEECEGDPATPMGVYD
GTSTWYQGVSPTPPPHPAPASSNCVTLPTVGVSDMLRRRGVDSVGGFETRKVPEFPGATP
APVAR

Enzyme Prediction     

No EC number prediction in CC1G_08066-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	28	119	2.9e-19	0.5053191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	7.62e-25	35	155	7	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.82e-19	37	157	8	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	4.87e-14	8	111	22	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.70e-13	35	155	3	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411519	lectin_2	7.00e-12	37	155	125	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA67406.1|CBM13	1.28e-146	16	390	12	386
QRV77601.1|CBM13	1.77e-140	13	390	8	384
QRW06545.1|CBM13	1.77e-140	13	390	8	384
QRV92416.1|CBM13	1.16e-138	13	390	8	384
CCA67412.1|CBM13	3.50e-137	21	392	18	387

PDB Hits     

CC1G_08066-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_08066-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999804	CS pos: 21-22. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in CC1G_08066-t26_1-p1.