CAZyme Information: CC1G_08058-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_08058-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: macrofage activating glycoprotein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		43896.92	6.0719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:3024609-3026593(+)

Full Sequence      

MTSMFEDISHALSSISNAIAGLVGAALITGAYAQTPEFQGELLLQPQPNNAKCLTASSNS
DGAPVVIATCVAGGSPSQKWVFSGGTVRVHGNKCLDVTDGVDQDGTKLQIWTCSATGNSN
QQWYYSKWDNTLAWTGKGNTGYLPTDLPNKSQNGQYGTNNCGTGSSQSSNCQTAWINSAT
DFCLYGPPSLGTIGDTERFAVSYCTKSGRGTRTIPDGTLQGVHFVRTPEYVQITGVGDFT
KMNIPFGDDGGEMDNRGADGKGNPIGGLLFGNTFGSGLQYHEWTQFISYREFCIRACIGP
RSKQLCNHIYDIMGCWWNIPANYSPGVYEECQGDPAIPMGVYGTSTWYQGVSPTPPPHPA
PASSSCSTLSTVGVTPLRRSLPRRDVPLEGGHVLRDYVEPHIPRATSPPM

Enzyme Prediction     

No EC number prediction in CC1G_08058-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	41	133	1.7e-17	0.5053191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	9.23e-14	49	132	9	91	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.04e-13	49	123	52	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.84e-13	49	124	50	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	1.09e-12	44	138	3	94	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.12e-09	52	124	48	116	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV92416.1|CBM13	3.34e-134	19	389	4	401
CCA67406.1|CBM13	3.96e-134	33	372	17	386
QRV77601.1|CBM13	1.35e-133	19	389	4	401
QRW06545.1|CBM13	1.35e-133	19	389	4	401
CCA67412.1|CBM13	2.33e-131	25	374	10	387

PDB Hits     

CC1G_08058-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_08058-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.141521	0.858445	CS pos: 33-34. Pr: 0.8017

TMHMM  Annotations     

Start	End
12	34