CAZyme Information: CC1G_07940-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07940-t26_1-p1
• CAZy Family: GH24
• CAZyme Description: alpha-1,2-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	AACS02000013|CGC4	45577.29	5.2884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000013:371632-373486(-)

Full Sequence      

MALKSVTSLSRGARPALLLVTLALLWLSLRNFDPESFRALLVPHPKLYSTQCENVQAPNQ
NHFGPVDTAPARRANATFVILARNSDLAGTVNSIKEIEDRFNRRYQYPYVFLNDEPFDEK
FKSRISILTDAKVEFGVIPRDHWNQPEWIDEGVAKSWREWMVAGDIIYGGSVSYRNMCRF
NSGFFFRHPLMEKYRWYWRIEPDVHFHCDINFDPFVFMEEHKKVYGFTITMFEYEATIMS
LWDNVREFANMYPEYIAPDNSLEFISDDGGETYNLCHFWSNFEIADLDFWRAPAYQAFFE
FLDYKGGFYYERWGDAPVHSIAAALFANRSQLHFFDEIGYEHPPYTHCPKRGNNWAKGRC
TCDPEENFDDFPGSCLSRWERFINGTLS

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	73	343	3.2e-123	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	4.58e-168	66	385	73	392	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	2.50e-143	56	344	18	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA77793.1|GT15	8.02e-153	66	383	60	376
VWO98657.1|GT15	2.72e-151	65	380	82	394
CCA75013.1|GT15	1.19e-146	49	369	62	390
QRV99898.1|GT15	9.47e-146	58	380	47	368
CCA73940.1|GT15	9.22e-145	64	384	29	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	6.39e-124	71	375	24	327	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	8.56e-94	53	361	54	359	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	1.62e-91	31	381	62	423	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27810|KTR1_YEAST	2.13e-127	65	379	64	376	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1
sp|P46592|MNT2_CANAL	1.12e-125	67	379	133	445	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|P27809|KRE2_YEAST	3.63e-122	46	375	88	421	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1
sp|O60160|OMH1_SCHPO	1.00e-119	70	379	66	373	O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh1 PE=3 SV=1
sp|Q00310|MNT1_CANAL	2.45e-117	73	384	108	419	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999933	0.000079

TMHMM  Annotations     

There is no transmembrane helices in CC1G_07940-t26_1-p1.