CAZyme Information: CC1G_07624-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07624-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		26389.78	4.7950

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:1362167-1363192(-)

Full Sequence      

MILLPIVLLGLATKVYSHGFVQEVVLGETSYPGYHPYVDPYPGSVEFFFVDTPSSRFLME
TAIGPVEQLDWIDVQCNGESATGYYTEPAPLLGKIAAGDIIKFNWISYGGAKDNHHGPML
TYMAKVPEGRDVREWSPDTEKVWFKIDHSGKDSEGKWAATDRLNEANGTYTARIPPNLQP
GQYLIRHEWIALHLAHSYPGAQIYPMCVQVEVTGNGTAFPTEFVAFPGEYTAETPGKS

Enzyme Prediction     

No EC number prediction in CC1G_07624-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	7	236	3.1e-58	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397484	Glyco_hydro_61	7.36e-71	19	236	1	199	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
410622	LPMO_AA9	2.40e-68	18	236	1	195	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFO72235.1|AA9	1.91e-75	14	236	18	229
UPO25260.1|AA9	1.74e-72	9	236	6	228
CCA73151.1|AA9	3.38e-72	8	236	9	225
UPO25277.1|AA9	5.32e-71	9	236	13	230
QRV82856.1|AA9	8.53e-68	8	236	8	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EIS_B	7.03e-49	19	236	2	204	Structural basis for substrate targeting and catalysis by fungal polysaccharide monooxygenases (PMO-3) [Neurospora crassa OR74A]
4EIS_A	1.12e-47	19	236	2	204	Structural basis for substrate targeting and catalysis by fungal polysaccharide monooxygenases (PMO-3) [Neurospora crassa OR74A]
7A8V_A	6.08e-32	18	236	1	206	Chain A, Lytic polysaccharide monooxygenase [Talaromyces verruculosus]
3EII_A	3.47e-28	88	236	45	185	Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_B Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_C Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_D Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_A Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_B Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_C Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_D Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris]
5TKF_A	1.38e-27	64	236	27	200	Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_B Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_C Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_D Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKG_A Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKG_B Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKH_A Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKH_B Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKI_B Neurospora crassa polysaccharide monooxygenase 2 resting state joint X-ray/neutron refinement [Neurospora crassa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00023|CEL1_AGABI	1.85e-25	9	236	20	230	Cellulose-growth-specific protein OS=Agaricus bisporus OX=5341 GN=cel1 PE=3 SV=1
sp|G2Q9T3|CEL61_MYCTT	3.59e-24	12	236	14	223	Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Cel61a PE=1 SV=1
sp|O14405|GUN4_HYPJE	6.81e-22	9	236	13	226	Endoglucanase-4 OS=Hypocrea jecorina OX=51453 GN=cel61a PE=1 SV=1
sp|Q0CEU4|EGLD_ASPTN	1.93e-19	65	236	51	212	Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglD PE=3 SV=1
sp|Q5BCX8|EGLD_EMENI	4.89e-19	65	236	50	211	Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999763	CS pos: 17-18. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in CC1G_07624-t26_1-p1.