CAZyme Information: CC1G_07600-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07600-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624	AACS02000004|CGC1	69413.38	8.7180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:2595367-2598039(+)

Full Sequence      

MSQASITFNNLSTRLGNNRFTWITAFAFALLLRQATKGRKPKLIADARRVAREVKEGELD
FDEYDVVIIGGGTAGCVLAARLSEDPSLRVLLLEAGGSGVALRETRIPVAYSLLFHTKHV
YQFFTEPQDFANGKKRFWPRAKMLGGCSSINAQMAQWGSPGDFDRWGDIIGDDSWKWSNL
KRYFNKFEKYVPHPDFPDVDVSVKGQEGPMKVGYFSEVSEGSKLFIKACQNVGIPFSPDF
NTSKGTLGVNKVVVNATVTKILTERVGGEIRTVGVEFAKSKEGPRYRVRARKEVVLSYNA
EPVLSTHLRSAFSPTILMLSGIGPSGELRKHHIPSVLDLPGVGDNLIDHPVVDLYFKNRY
DDSPKHVKPSSLGDVVKFVTSTLKYFITRSGSMATNFGESAAFVRSDDRALFPESAYPEK
LHDTTSSAIGPDLEIFTTPMAYKVQIYLLEHGDFTFPMHTFAIHVVLLRPRSKGTLRLKS
ASPWDAPAMNPTYLERPEDVHKLVRGVRLITKIARQEPLVQRLDHSDKDPLLDSDTYLKS
DKELEELVRERLETLYHPTSTCRMAPLEDGGVVDSRLRVYGVKGLRVCDASIFPEIVSGH
TAAAVLATAEHLADIIKADLKEGH

Enzyme Prediction     

No EC number prediction in CC1G_07600-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	251	619	1.6e-87	0.6056338028169014

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.74e-117	63	617	5	532	choline dehydrogenase; Validated
225186	BetA	2.43e-103	63	619	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.55e-44	470	612	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.46e-34	64	595	56	555	Protein HOTHEAD
366272	GMC_oxred_N	4.55e-23	131	351	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB50190.1|AA3_2	6.19e-148	43	605	59	679
QRV97653.1|AA3_2	8.16e-148	63	618	64	628
QRV83544.1|AA3_2	2.78e-147	41	618	43	628
QRV83543.1|AA3_2	1.25e-146	48	618	48	627
QRV97654.1|AA3_2	1.39e-143	48	618	48	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NCC_A	5.71e-59	44	616	5	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YRU_AAA	5.86e-59	63	616	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	5.86e-59	63	616	7	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	5.86e-59	63	616	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	6.13e-59	44	616	65	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	6.00e-100	64	617	36	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q47944|SDH_GLUOY	9.75e-80	64	617	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	4.39e-71	62	617	41	574	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.67e-70	64	616	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	1.79e-69	62	617	44	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999617	0.000401

TMHMM  Annotations     

There is no transmembrane helices in CC1G_07600-t26_1-p1.