CAZyme Information: CC1G_07595-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07595-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		72185.32	7.7976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:2575530-2578061(+)

Full Sequence      

MASSNNALAPVPEALVELVTKLHEVVTTHPTGVPFIDALSPTTRALLASSSVLAVLVELL
VRGQRVKSLKTKAESMNKAKGGSGQYVDSEDLGAAIEEARRLGGLAEKEWEYDVIVVGGG
TSGCALAARLSEDPNLKVLLLEAGISGKTLPRSVMPSGFGGLFWGKHVHQLRTEPQQYAG
GKTNFWPRAKMLGGCSSINAQMAQYGAPGDFDEWATVTGDDSWAWKNFAAYFRKFERFNP
HPEYPDVDMKNKGTDGPVDVGYFNTVTPPSKAFIKACVAVGIPFTPDFNGLNGTLGVSRN
LTVATNATATRIIFDTTSLGSAAEPRAVGVEFAKTEQGKRFKVYAKRDVVVSGGAVHTPH
LLMLSGVGPQAHLEKLGIHVVKNHPNVGQNLVDHPVIDVYFKDKHNQSANYLKPKSLGDA
VKLFKAIWQYKIEKTGGPLAMNFGESAAFVRSDDRSLFPADKFPEQLKDSTSAANSPDLE
FFSTPFAYKEHGKIMFDVHTYALHCYLLRPTSKGEVLLKSANPFVQPSVNPNYLQTTEDV
KKLARGLYLMLKIAQTEPLASHLDATFTREDLDHQTHLKSPQELEELVRERVETVYHPTT
TCKMAPEDKGGVVDTKLRVYGIKGLRVCDASIFPYIISGHTAGGCFAIAEKLADEMKAEY
RS

Enzyme Prediction     

No EC number prediction in CC1G_07595-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	299	658	1.5e-100	0.6091549295774648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.06e-130	111	654	5	529	choline dehydrogenase; Validated
225186	BetA	5.65e-106	111	659	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
273814	betA	5.73e-87	113	654	1	524	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
366272	GMC_oxred_N	1.76e-39	179	396	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.34e-37	112	633	56	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB50190.1|AA3_2	6.19e-156	93	642	61	676
QRV83544.1|AA3_2	2.67e-155	66	660	24	630
QRV97653.1|AA3_2	3.50e-154	38	660	2	630
QRV97655.1|AA3_2	2.90e-151	38	660	2	640
QRV97652.1|AA3_2	3.50e-151	40	660	4	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.41e-64	111	659	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.41e-64	111	659	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	7.62e-57	112	661	7	574	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
6YS1_AAA	7.77e-57	111	653	7	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5ZU3_A	1.05e-56	112	661	7	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	2.21e-95	112	657	36	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q47944|SDH_GLUOY	5.29e-89	112	654	5	525	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.53e-82	112	654	2	525	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	1.17e-80	111	657	45	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q00593|ALKJ_PSEOL	6.30e-80	112	654	2	525	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_07595-t26_1-p1.