CAZyme Information: CC1G_07510-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07510-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		51212.56	6.8956

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1390579-1392656(+)

Full Sequence      

MHLATSLSLAVILSAVYVTGNPAPVPSTTALCPNAPKPTSALKVAPGFEGTAVVGGISNP
RGITLDKRGNILVVERGVGVTGHFVDKNGCVTRSKVIVDDYNLNHGIDISADGRTLFATS
REFAWSWDYNARTMTATNRRTLVTGMLTEKQLTRTIIASKVNPNFIAISISAGDGPDYEA
FDPAVGRAQVRAFDLTKLPRGGAAYNSSYGRVLGYGLANAVGIAEDHQGFIHAGDNGGTT
HRFIGGVGTGVGNDNPAEGVFKLSNPRRPESSFAGYPYCFPVWDSNAIQDRRFERGEWSA
ILPETEYNDEWCQREAARPSLILPPHSAPLDMKFGPRGDDSLYVAMHSNGYIDPTQGFKV
VKISGSYPKAGVSGWTATDASARLNVTFTDILLNDVETEDQCLRGGCFRPLGLVWSQDGD
KLYVTSDNTGEIFLLKKKPTQRLWGQWYASARLVDYSMEDRETARRELSANM

Enzyme Prediction     

EC	1.-.-.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	35	435	7.6e-98	0.9875311720698254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.33e-04	1	368	8	354	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAU83856.1|AA12|AA8|CBM1	1.14e-125	27	437	239	649
BAP91034.1|AA12|AA8|CBM1|1.-.-.-	1.14e-125	27	437	239	649
CAE7000862.1|AA12|AA8	7.18e-76	22	435	240	648
UQC91657.1|AA12|AA8	5.85e-74	23	437	179	589
EJT78573.1|AA12|AA8	1.78e-73	32	435	324	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JT5_A	1.15e-130	32	437	5	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
6I1Q_A	1.06e-43	45	437	14	402	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.09e-43	45	437	15	403	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.11e-43	45	437	16	404	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

CC1G_07510-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999720	CS pos: 20-21. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in CC1G_07510-t26_1-p1.