CAZyme Information: CC1G_07491-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07491-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		43260.39	6.8553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000006:1345788-1347359(-)

Full Sequence      

MFSPSFIRAIQVALLLPTTIVFASPVASNASVVQTRAAGGLADAAKAAGLRFFGASTTVD
QLNDEPYAELLSNTSDFNLVTSLEQFVWGSIERQPGQYDFSVADRLIAFAERNGQLVAGG
TLVDAVRHYRAPGYINPLPNKYPPDDIRVALEKFVTAVVSRYRGRVRKCLILQFQARGRC
AHLTLKITGMSPEPKDVTFGRFFSVEWGVGVTDYLQIALRAARKADPNVKLYVSNAYLEE
FTGRNVTDFPAMLNLVKRLQAENVPIDGVNFWLDLFALPSIPPEGDFYSNLVSKFRQLEE
LGVEGTLGSTSIWTEEDRPWNPPAAPLHAQVYRDVVRACKDSKACVGINLASLTDKYQIL
IDAGPINPYPWDKDLQKKEHIYNAIRDGLVG

Enzyme Prediction     

EC	3.2.1.8:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	41	384	6.6e-35	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	4.99e-50	41	387	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	1.25e-39	88	385	3	263	Glycosyl hydrolase family 10.
226217	XynA	5.42e-22	18	387	7	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB05886.1|GH10|3.2.1.8	7.43e-36	48	388	26	330
CAB05665.1|GH10|3.2.1.8	7.43e-36	48	388	26	330
AWU22293.1|CBM1|GH10	7.46e-35	17	390	76	395
AEJ35165.1|CBM1|GH10|3.2.1.8	2.48e-34	18	390	65	393
AFR33047.1|CBM1|GH10|3.2.1.8	4.93e-34	44	390	85	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	3.72e-31	40	389	2	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	5.10e-28	15	389	4	339	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	8.04e-28	41	389	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.53e-27	41	389	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
1V6Y_A	5.94e-25	44	389	7	314	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60206|XLNA_AGABI	1.32e-36	48	388	26	330	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B7SIW2|XYNC_PHACH	1.17e-31	45	389	88	397	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	3.53e-31	45	389	98	406	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|G4MLU0|XYN5_MAGO7	1.37e-27	40	365	37	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	1.37e-27	40	365	37	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000390	0.999594	CS pos: 23-24. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in CC1G_07491-t26_1-p1.