CAZyme Information: CC1G_07396-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_07396-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		47132.44	9.7210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000003:2081757-2083069(-)

Full Sequence      

MIIAVLLDALSNLVPLFDKSPLLVTPNSSPLVRWDAIHFLAIANNGYQFEQQWAFLPGIA
LLVRAFNALLGLEFGVKGVSLLISLLTLDSFRVLYELSLIHLNSEKLAHIATVLALFPSS
PATLFAVPYNEPFFTYFSYRGMLFCARKQWLLAALSFAAATTFRSNGIFLAGYIIWGLLV
LPYLSNPSINLKLLLSTIYTALLTALVFVPFIGHNYHGYHTFCIPPPASSTAVTFTPPDW
CNKPIPSIYTHVQAEYWNNGLFKYWTIQQLPNFIIGAPPLILLFTFGVWHLRQVLPTLFS
KPAPSTAPRSNRKPMDASKAEPDIVKKKDESTSNPFTSLSLTPHVIHALFTSSILLFASH
TQIILRLAAAMPTLYWAAAWLWYVPPGTTATKTRYAKWWIYWSAIWGLISIVLWVAFLPP
A

Enzyme Prediction     

No EC number prediction in CC1G_07396-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	29	421	3.2e-83	0.8746928746928747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.59e-35	31	421	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.46e-09	1	421	40	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA72745.1|GT76	1.14e-80	17	421	45	430
QRV77141.1|GT76	1.29e-59	32	421	97	535
QRW06081.1|GT76	1.29e-59	32	421	97	535
QRV91959.1|GT76	3.72e-57	32	421	96	534
ADV21212.1|GT76	2.15e-46	7	421	25	425

PDB Hits     

CC1G_07396-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP62|GPI18_CRYNJ	1.44e-44	6	421	24	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|P0CP63|GPI18_CRYNB	2.80e-44	6	421	24	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|Q09712|GPI18_SCHPO	3.60e-28	32	421	126	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q5KR61|PIGV_RAT	1.03e-26	31	381	63	420	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q4I0K3|GPI18_GIBZE	6.27e-26	31	293	62	328	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998685	0.001303

TMHMM  Annotations     

Start	End
65	87
107	129
162	184
191	213
269	291
336	358
363	385
398	417