CAZyme Information: CC1G_06734-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_06734-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: chondroitin AC lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727		80698.96	6.9810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000001:1705089-1707824(+)

Full Sequence      

MALAGVHKWELARCRLDSLDNLTGKWPDTEVDYTTGCGARRANWPAQAHWQRILVMSGAW
HGGYRGAEQWVKDERLRTTIGRAMEYWFSRDITNVDCLDWGGTPRCPCDNVDDSLWNTNW
FSNIILIPRLAGQSCLLLSDSLTLREREVCSNITRRSFGTFGIKLNQVGYLTGANTLDVA
RVGIDCGLLNSNISMIADAYRRIHDELVIQNVTKVDGIRADGSFAQHAGVLYNGNYGKDY
SNAVLDVEVIAAGTSFSADTTAQTAFETLFDGHRWMIFSNTLSQVLHFDFSVLGRFITFP
VIDDQATGSIQINLTKTWELGRLWSSPSLTTFGESLMQNFSSANAGGLTGTRMFFANDYM
VHRGPNFFSSLKMYSSRTLNTECINSQNPLGFHLSDGTLYTYLRGNEYTDISAAWDWDLI
PGTTVDYRNTLLHCSGATVTGRESFVGGLSDGKTGIAAMRYTNPTTRSLRWQKTWFFLND
GAQHVVINILASSSGAPVYSVLDQKRRNGLTVVDRREVLNSSTITGPQRLWHDNVGYAFR
SLTNATTPLHVRMGERTGSWSAIGTSTQPPVSVDMWAGLLEHIDLSQPLEYTILPGTSYP
DFLQRTELPRVETIANNDNVTAIYDQRTGIAMVVFWNNGESSIAIDTRTPIAQMTITSTA
NVIVMFSTKNGTVLVSDPTQMLDTVVLKFTIGRGKRPLYWKGQAEKSLVFQLPGGGRRGD
SVSGTIR

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	354	577	6.1e-48	0.9176954732510288

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	2.34e-90	351	598	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	1.69e-85	43	678	60	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	8.90e-17	16	297	36	284	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	6.65e-12	614	685	1	66	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96784.1|PL8_4	1.19e-228	24	726	132	818
QRW05711.1|PL8_4	1.30e-197	17	723	50	779
QRV91644.1|PL8_4	2.59e-197	17	723	50	779
QRV76817.1|PL8_4	3.67e-197	17	723	50	779
QRW05707.1|PL8_4	1.32e-194	24	726	54	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WCO_A	5.34e-26	119	680	139	713	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	6.63e-25	119	680	139	713	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
1F1S_A	3.07e-15	173	643	257	775	Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase At 2.1 Angstrom Resolution. [Streptococcus agalactiae],1I8Q_A Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Enzyme Product, Unsaturated Disaccharide Hyaluronan [Streptococcus agalactiae],1LXM_A Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan [Streptococcus agalactiae]
1N7O_A	1.11e-14	67	644	87	679	Chain A, hyaluronidase [Streptococcus pneumoniae]
1OJM_A	1.12e-14	67	644	87	679	Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q53591|HYSA_STRA3	2.58e-15	117	643	368	945	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
sp|Q54873|HYSA_STRPN	1.39e-14	67	644	373	965	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000024

TMHMM  Annotations     

There is no transmembrane helices in CC1G_06734-t26_1-p1.