CAZyme Information: CC1G_06510-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_06510-t26_1-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: copper radical oxidase variant A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	AACS02000012|CGC4	83019.71	4.6693

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000012:1419613-1422134(-)

Full Sequence      

MLSPSLSLLALGLASVAPALAAKPGGFEDGGDTLVSAMMMFVGNEEKVYILDKAEGNAAQ
VNNHPAWASVWDINTRLAEVMDVPSNVFCSSGMHLPNGSFATFGGNGAVGRGGQIGSVKN
PGGFTASWDAEYQNSDGSRAIRILDPCTSADDFNSRQCRWFDDATVLAMKVPRWYSTAEP
LADGTIVMIGGFTTGGYINRNYPNTEPNGGGSQNSYEFFPARDGDPPNLPFLTHTSGLNT
YVHAFMMPSGLMFLQANVSTTLWNYNDNTETRLPDMPNGVVRVYPASGAVAMLPLTPANN
YNPTIIFCGGTDMKDEEWGDFAYPYINTWDYPASKDCQRITPEPEDGSAPVYEQDDDMLE
GRTMGQFIILPDGKLLVLNGALNGTAGYAQSTLLVESYADMPWGESLAAGPVLTPAIYDP
NAPRGQRWTRAGLEEAKYPRMYHSSAMLLPDGSVLVAGSNPNVDVNLTTIFPTTYAAEIF
YPPYFSAPVRPVPSGIPKTLSYGGEPFDITIPATSYSGSANDAADATVVSVLRGGFTTHA
MNMGQRYLQLENTYTVQSDGSIVLHVAQMPPNPNIFQPGPAFVYVTIKGIPSNGTYVIVG
SGQMGPQPTQAASTLPPSVRLDTAKGAADGSQSGKNTESTDGKVEESGGLGTGAIIGLAA
GGVAAIAILGALLGVFLARRRRAAGRDAATNYPMAGAGMASVGGAGAFAAGARGVRDSDS
SAFVPLAHGNHSHTWNQSTASLVSPYKDHDMPSRASGTGISMEYDPYGNPSHSGVQHPYS
GQPHRY

Enzyme Prediction     

EC	1.2.3.15:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	21	618	5e-219	0.9875666074600356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	9.39e-30	85	310	65	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	1.26e-23	497	599	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	1.92e-19	485	599	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD61573.1|AA5_1	7.83e-290	6	672	2	671
QRV89993.1|AA5_1	7.20e-278	13	682	17	671
QRW04219.1|AA5_1	2.34e-276	13	682	17	671
QRV75303.1|AA5_1	2.34e-276	13	682	17	671
QRW18212.1|AA5_1	3.20e-274	19	618	21	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	1.33e-10	169	599	253	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	6.20e-09	169	599	242	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	6.24e-09	169	599	247	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
6RYV_A	8.99e-09	169	603	312	695	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001],6STX_C Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
6RYW_A	8.99e-09	169	603	312	695	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	8.76e-79	35	609	37	557	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	1.05e-51	66	597	74	519	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	8.65e-46	59	597	147	612	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	7.11e-40	62	597	120	591	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	6.96e-24	81	616	477	922	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999762	CS pos: 21-22. Pr: 0.9769

TMHMM  Annotations     

Start	End
655	677