CAZyme Information: CC1G_06381-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_06381-t26_1-p1
• CAZy Family: GH131
• CAZyme Description: Cap3p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		79346.70	8.1038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:1983328-1985592(-)

Full Sequence      

MALRFRLQRPYIRWAVGLALLVSVFIVYTQFYAWLNELSVTITAKISVPHWGPITHDTFG
FPLKTSDPPQDHAATVQPGSARHFYRDDGLLEVNPDGPHPIFELVKKAEENWKRKNDRAS
RTLKEACLEYERRHNRKPPRGFDVWWTYVQVYNVPLPDEYDLISRNMAPFWGIHPRRLQQ
NQRDREGYADSFTLGKDTDRSRMRLLNYALNDMSRKGHFTSGARTVSKLLEEVDEFIPAF
RAVFNPHDNPNLLSDYGLLQAAIQAGKEGRYLDLDDVPPGNEEGNWLASCHPESPARTQS
IDLSDGDPSLTKLLKLKHNSPYASGHRRNYPKTFIHDHKLSMNPCLHPSHLLTHGQFIHS
NMDGSTTDRLLIPQFSYSPTALHHDIALAMPYNWVRDVLPRVDDPPFEEKKDSRLEWRGS
TTGLYFGPPGPWWLSQRTRLVAWANPWAKLPFIADSILQSPPDEQWRVGEAVALNDSTVK
WAQPRMTDVAFAGRPLDCAPETCRRLTREYEFRLKHDFKTQGKYKYIIDVDGNAWSSRFK
RLITSNSLIFKSTIYEEWFADRVEPWLHYVPIQVDYSDLLDTLYFFQGDPSGFGGHPALA
KKIAEAGRQWSLTHWRKVDLTAYMFRLFLEYARVMSVERDRGGMDYIYDEKDEYDPRDAE
GVGSRIGSQSKFLQVMDRRRQRGVL

Enzyme Prediction     

No EC number prediction in CC1G_06381-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	367	635	1.1e-58	0.912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.49e-21	508	635	129	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.72e-16	508	635	199	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW03676.1|GT90	3.75e-140	83	640	117	645
QRV74770.1|GT90	3.75e-140	83	640	117	645
QRV89460.1|GT90	2.32e-138	83	640	117	645
CCA67199.1|GT90	3.59e-131	81	640	88	619
CDR40950.1|GT90	4.10e-110	48	649	124	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.20e-13	523	642	236	351	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	3.70e-11	518	638	266	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	5.92e-82	66	651	118	672	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	2.07e-16	512	656	337	488	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	7.80e-14	512	644	338	477	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	8.03e-14	523	636	264	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	8.03e-14	523	642	264	379	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

Start	End
12	34