CAZyme Information: CC1G_06005-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_06005-t26_1-p1
• CAZy Family: GH11
• CAZyme Description: fungal cellulose binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		34352.62	4.8519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000003:258061-259398(+)

Full Sequence      

MVNFKALASVLLASATLASARPPRVPPKGRSGPNYWFSFGDSYTQTWFNHTDTPPAPGNP
LGNPPYPGWTATGGPNWVGYLTTEYNNSLVLTWNYAYGGAVIDDKLVTPWQPGLIHLTGQ
VDQFLEYAAKKPAVVPWTSKNALFSIFIGINDIGNSWWLPGSRDEFNDVLLDAYFGLVQK
LYDAGGRNFLFVNVPPIDRSPLMLEQTDDAGRAIEKEVIASYNRKLLERIEALKATDRKI
KTFFWDSNAFYTKVLDSPQEYGFKDATSWGKEDPEIFWGDNYHPSTYADKLFAEDIARNV
LADTVW

Enzyme Prediction     

No EC number prediction in CC1G_06005-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	37	296	2.9e-82	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.53e-64	39	298	5	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.26e-29	37	296	4	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.04e-10	37	296	2	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	1.49e-10	3	303	4	336	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	4.26e-10	37	301	5	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW16157.1|CBM1|CE16	2.67e-94	26	297	87	355
QRW01573.1|CBM1|CE16	6.66e-93	31	297	106	367
QRV72536.1|CBM1|CE16	6.66e-93	31	297	106	367
QRV87408.1|CBM1|CE16	9.43e-93	31	297	106	367
CCA72470.1|CE16	7.29e-85	1	297	4	296

PDB Hits     

CC1G_06005-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	8.59e-78	8	297	9	294	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.77e-76	8	297	9	294	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|O23470|GDL64_ARATH	1.75e-09	80	303	92	352	GDSL esterase/lipase At4g16230 OS=Arabidopsis thaliana OX=3702 GN=At4g16230 PE=3 SV=2
sp|H6U1I8|GLIP_TANCI	1.04e-07	141	294	158	332	GDSL lipase OS=Tanacetum cinerariifolium OX=118510 GN=GLIP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999761	CS pos: 20-21. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in CC1G_06005-t26_1-p1.