CAZyme Information: CC1G_05454-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_05454-t26_1-p1
• CAZy Family: GH10
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	AACS02000011|CGC2	60264.19	5.0231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000011:1596672-1598273(+)

Full Sequence      

MTQDNKPVPDPSFRFTDSQDWFSHNIESWKALLPIVTRNDPRILEIGSWEGRSAVFLATN
LCKDGEIVCIDHFDLFNTDAGKERYERMQHNLGLTGKRFRILPEFSFPALMKLLEEEMGR
EDPGYDWIYVDGSHRADDTLLDGELAWRLARKGAVVIFDDYHWDATPEDSAEHPKRGIDA
FLSLHRGEYDMLSRPENYQVVLKKTSEMRIGFLIPHSQPITATQVAAFGYSINIATATDS
SYAMPASVLLATLVKHTPGRISIYVGDCGMTDQDRDMMERSLPKRDDVTMVFIPLGDETL
ARKWSGKWAKVDLLAKLPVERALYLDADILVRRDISELWHTDLGDKAIGAVIDVGYPMGC
SGLPRREYFNSGVLLLDLAKVRSKLTATFDQLCEQFQKSDQDALNAHFGGDDWKSLSLQW
NAQGLGTYASSYAPDRHVVDLAQMDNPAIVHFTGPLHPSLADVLNPWVQPYTAKPWGYAG
SPGHPFAQEWFEALSETVWMPYYEDKWKQVCQQAKESAISKATEDFKAKVTLN

Enzyme Prediction     

No EC number prediction in CC1G_05454-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	224	458	5.5e-41	0.8949416342412452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133037	GT8_A4GalT_like	1.37e-46	232	476	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	6.63e-28	233	478	1	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
224359	RfaJ	2.37e-26	232	506	3	273	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
404466	Methyltransf_24	6.05e-19	44	161	1	106	Methyltransferase domain. This family appears to be a methyltransferase domain.
132996	Glyco_transf_8	3.66e-17	232	458	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV90439.1|GT8	2.45e-183	13	528	10	539
QRW04586.1|GT8	5.64e-182	13	530	10	537
QRV75676.1|GT8	5.64e-182	13	530	10	537
QRW23776.1|GT2|GT8	4.10e-175	13	499	948	1441
AMS44207.1|GT2	6.87e-27	18	205	10	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1G9R_A	5.53e-13	233	458	2	251	Chain A, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	7.42e-13	232	458	1	251	Chain A, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
5GVV_A	1.27e-08	320	511	100	280	Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVW_A	1.27e-08	320	511	100	280	Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9AEU2|GLY_STRGN	1.64e-10	320	452	106	231	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
sp|A0A0H2URH2|GLYF_STRPN	2.74e-08	320	454	95	224	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
sp|A0A0H2URJ6|GLYE_STRPN	6.55e-08	320	511	100	280	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1
sp|P27129|RFAJ_ECOLI	8.76e-07	314	471	118	284	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
sp|A0A0H2URH7|GLYAT_STRPN	3.59e-06	320	452	393	519	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_05454-t26_1-p1.