CAZyme Information: CC1G_05389-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_05389-t26_1-p1
• CAZy Family: CE9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	AACS02000008|CGC7	51083.99	9.3639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:192453-194019(+)

Full Sequence      

MARFSLLATLGLFLGLVWTALAAPRVSQIGNSLLDNNGIYFVSYDGLVNVNSFQLSNLLT
YGNYQYAAWYTSSRFAILARRQLPNGGWQTLQLPRQLSSNNSHNVVVIGISPEDGRIHVA
LDCHSSRVFYTVSEPGLAFNGNLSWVSSRFGGISNNLGNLNVGTQVTYPQFVVTPDNLLQ
FVYRSGVSGNGATQLAEYRNGVWTNVGSWATNSGSYSARGVTSNARNLYIHGFTYRNGRL
HVTGTWREQAGGVMCNGGGLTNHDTVYFYSDDRGRNWRNSGGAHIATSGSNPVRVSSPGI
IVDPINADHGLMNQESQDVDSQGQIHAIISYVPGRFTQCVTSYQRDRTSYARPFHVFRSP
NGSFTKREIPFALNAVGRSQIVIDKNDDIYVVLPFVRVVSASKSSGYTDWTMVFDGVAQG
LNAFGEVTVDRARMREEGILSVFYQLRSSGNNPSQVRVIDFALNT

Enzyme Prediction     

No EC number prediction in CC1G_05389-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	48	346	6.2e-77	0.918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	2.08e-98	64	370	1	272	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EFJ01384.1|PL42	8.08e-208	3	463	7	459
QRV85451.1|PL42	6.54e-203	16	464	12	463
QRV99514.1|PL42	6.54e-203	16	464	12	463
QRW26468.1|PL42	2.05e-189	18	464	18	452
AVT29231.1|PL42	4.92e-178	22	463	32	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	2.64e-34	48	464	23	420	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	2.64e-34	48	464	23	420	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	4.70e-33	48	464	25	422	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MUK_A	1.57e-17	48	391	35	346	Glycoside Hydrolase BT3686 [Bacteroides thetaiotaomicron VPI-5482],5MUL_A Glycoside Hydrolase BT3686 bound to Glucuronic Acid [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

CC1G_05389-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999739	CS pos: 22-23. Pr: 0.9818

TMHMM  Annotations     

There is no transmembrane helices in CC1G_05389-t26_1-p1.