CAZyme Information: CC1G_05295-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_05295-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: alpha-L-arabinofuranosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		64674.72	9.0134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000011:976988-980051(-)

Full Sequence      

MAVTVTVNAAASHEIPSTLCTAASLTGWQALNGATIRVIRESTPVSSRLPNALQVVFPRG
RPGAAGFANTGYAGIKITSGTTYKASFYYRFPNRSNFNGNLTVRLQTANGQVLATANVPV
SGSQTTWNQVTFDLVATATPSSTSNLFSITADGAQAAGQTIHFTMLSLFPPTFKNRANGM
RVDLAEALVELAPSFFRFPGGNNLEGQTVERRWQWNATARWSIDREARSNGRLDLCQHRL
PSGLGLLEYLYWCEDINAEPIMGVWAGYALGGTSVPENQLGPYIQQAIDQINFAIGDPDK
SAPAALRRSLGRTEPFAMRFVEIGNEDWFASESYIYRWKHFANALQAEFPQLSFIATTRP
YDPVLTPRPTHYDVHVYQTPTWFAQNSFYYDSFQPPYRPFPFTQRNGTKYFEGEYAAIST
NPNDLFGSPANGRLVYPTMQSAAGEAAFMTGLERNSDIVFAAAYAPLIGHATRNQWFFSV
YRGDEYLPSTLPSRTGTQFWSVVRKKSTREIIIKTVNVAPSAGQFTFVLPFNNVASTGTA
YILSGGGTSSNTPSNPNAIVPRTVTIPTGKRFDFTAPGVSVCILIFEAY

Enzyme Prediction     

EC	3.2.1.55:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	158	471	5.7e-54	0.45396825396825397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399741	Alpha-L-AF_C	3.01e-33	413	580	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
214830	Alpha-L-AF_C	1.07e-20	436	580	17	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
226064	AbfA	1.39e-15	165	328	35	175	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
397476	CBM_6	1.34e-05	63	151	23	125	Carbohydrate binding module (family 6).
271150	CBM6_xylanase-like	5.08e-04	98	138	59	99	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV30322.1|GH51	7.85e-245	24	588	75	646
CCC33068.1|GH51|3.2.1.55	2.36e-231	4	588	22	645
CCC33069.1|GH51|3.2.1.55	2.36e-231	4	588	22	645
CAL81200.1|GH51|3.2.1.55	3.02e-226	1	584	15	638
KDQ27940.1|GH51|3.2.1.55	9.01e-224	21	588	23	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	3.44e-227	3	584	1	622	Chain AAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|U6A629|ABFA_PENCN	5.49e-82	24	584	69	628	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
sp|Q0CTV2|ABFA_ASPTN	3.84e-81	24	584	74	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
sp|Q2U790|ABFA_ASPOR	5.99e-79	25	584	75	626	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
sp|B8NKA3|ABFA_ASPFN	1.64e-78	25	584	75	626	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
sp|Q96X54|ABFA_ASPAW	6.33e-77	21	584	71	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori OX=105351 GN=abfA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999454	0.000603

TMHMM  Annotations     

There is no transmembrane helices in CC1G_05295-t26_1-p1.