CAZyme Information: CC1G_05246-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_05246-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		32216.83	4.6497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000011:841219-842391(-)

Full Sequence      

MFPSSKRLSAVLSSLLILSSDVAYGVKRYEIVNNCPLSANLYINHDAQGTLAANGGTVTR
EYSDEWDGYIFTDLNRGNARDRAGTIRAGFLNRFDFYWISYDQKWRNVGVSIQPVDAVQA
DGFCRPLECLVDACPQGAPYEPQRFPLPYDPTNGPPPTPIYGCPATTYRVTFCPDGEIPH
LQQGPNNIHPESSMEKCLDVRADLFENGTPVQINNCDDSPGQKWDIKRGGQQIRLYGTNF
CLDAGSSSPEEGAQVTIQQCSEGSPSQQWDYGTDDRISLPSSGKRISTLLGK

Enzyme Prediction     

No EC number prediction in CC1G_05246-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	171	272	7.5e-16	0.48936170212765956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	2.79e-17	187	284	2	95	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	5.74e-17	196	284	12	98	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.19e-14	195	269	54	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.08e-13	195	286	7	91	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
238092	RICIN	5.77e-11	193	270	50	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	4.57e-25	178	279	26	128
AAW46144.1|CBM13	8.73e-14	188	291	36	140
UOH83865.1|CBM13	1.14e-13	188	284	36	133
AGV14186.1|CBM13	2.88e-13	188	284	36	133
AUB23598.1|CBM13	2.88e-13	188	284	36	133

PDB Hits     

CC1G_05246-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6WV19|GALT2_DROME	4.02e-06	205	272	567	630	Polypeptide N-acetylgalactosaminyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=Pgant2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000635	0.999335	CS pos: 25-26. Pr: 0.9675

TMHMM  Annotations     

There is no transmembrane helices in CC1G_05246-t26_1-p1.