CAZyme Information: CC1G_04900-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_04900-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	AACS02000002|CGC2	95944.95	5.5958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:3581485-3584738(+)

Full Sequence      

MAPSDFAKANIDEIVEQLTTDEAILLTAGVGFWHTHPIERLGIPAVKVSDGPNGIRGNHF
FMSTPAKCLPSSTALGATFDPDLVKVVGLKLIAEEAKLRAASVVLAPTCNIQRNPLGGRS
FESFSEDPWLSGQIAAAYVNGIQNGGIGTTIKHYVGNDKENDRMGYDSIISPRALREIYL
MPFMLAQKLAQPWSYNRVNGTHVSESPYFLKDILRDEWKSDALVMSDWFGTYSVAHALNA
GLDLEMPGINKWRTLEKVNRTIQARKVTPRTIKERARTVLELVKKCAAGAGELLDGDGLE
RTVESEEDKILMKDVARESIVLMKNEKKILPLDPAALKGKKVAIIGGNAKATVLSGGGSA
ALKASYFISPYQGIVDALGSDVEVTYSEGARTFMNLPTLENILQTDKGERGWIGTWHPHT
NDDSLVPLDQPIGDRFIDETRIFISNSAPEGITKRWTLKLKGYMKVEESQEWEFGLTVAG
RAKLYIDGNLVIDNWTRQIRGESFFGSGTPEKRGVYPLEAGKNHEIFVEFCNVRGPADGD
EDEALMDRYVLMSLQPNFSLTACTSSSNPGVRLGAAPVHDPDQTLAQAVALAKEADVVIA
IVGLNADWETEGYDRKTLALPGRTDELVQKLAEANEKLVVVTQSGSAITLPWVDQVSSLV
HAWYLGNATGLAIADVLFGKHNPSGKLSLTFPKREEDVPSFGHFHSEDGKVRYAEDLFVG
YKHYVARNIEPLFAFGHGLSYTSFSLSNLQVSAPEYKTAADGSKDLAINVSLTVSNTGSL
PGSEIVQVYVTPPSTSPLTHAPLQLRAFSKVKDLKPGEERKVEVTLDKYAVSYWSELLDR
WVVEGGSTWGVKVGTASDKLTLEGSVKVEKGFEWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	247	5.8e-56	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.11e-67	70	859	121	756	beta-glucosidase BglX.
224389	BglX	5.93e-61	40	374	57	383	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.76e-51	572	721	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.87e-35	40	282	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.26e-29	14	827	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAG59831.1|GH3|3.2.1.21	0.0	1	877	1	862
CDJ79822.1|GH3	0.0	1	876	1	859
CAC03462.1|GH3	0.0	1	877	1	861
AMK37826.1|GH3	0.0	1	877	1	860
ADX07318.1|GH3	0.0	30	846	20	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.19e-197	7	877	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.57e-194	7	877	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.21e-122	10	868	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.46e-104	15	874	9	675	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.10e-88	11	868	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	1.55e-226	5	877	8	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	1.03e-221	11	877	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	2.91e-221	11	877	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	3.51e-218	10	877	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.89e-217	10	877	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CC1G_04900-t26_1-p1.