CAZyme Information: CC1G_04713-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_04713-t26_1-p1
• CAZy Family: CE16
• CAZyme Description: NCP1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878		99592.72	6.1886

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000013:583904-587504(-)

Full Sequence      

MEYDSFDAILHYIFRSTQGDAWFKPSEENVSAGVCIRVEPGHYRVFPYENPFLTPFEAAV
RELNPLIATKVRSAAVHSALATVSEDSTAIYIDANTRIQILDTVSHLARADKEQCGAFLR
DERVLVVWCDDLDQIIPLCTEFNEKIMKLVWRTRMMHTSSIFTSRSSLPVPSIGSSAHIN
EKAPDIIPTVGTTKPVEPEQPPPPPRKWYSWKLSRSKPTSATQSSDPEKGDDRQERPVRL
FAPFYAGLGFGLSVFFVASGLAIVLQEFRLDGDFTRFALLVTFPFLVCVALFFALQIIAN
VSFCIGPVAQYHENSKYYSAIKPAPNDEVDSKLPHITVELPVYKESLEDTIAPSVYSLKK
AMQTYARQGGTSAIFVHDDGLQLLDEAEREKRIAFYADHNIGWVARPPHSNDPDGFQRAG
RFKKASNMNYGLQLSLCMEKHIMALEASGEKFDDPFQPLEERALELAVEEIYEQSGKRWK
PWACNARSLRIGDIILLVDSDTIVPEDCFRDAARELHECPEVAIIQHESDVMQVAHHYFE
NGIAYFTRRINKCISMGCANGEVAPFVGHNAFLRWSALQEASFVDPDDGVTKVWSESNVS
EDFDMALRLQLKNYIIRWATYSEGGFKEGVSLTCDDELNRWQKYSYGCSELIFNPIIRWW
RLGPITKQLRVFLWSSAPVHYKITMMSYMFSYYGLAGSFLLSVINYLMLGLALEVDGFYM
HSFEIFLACTVVFPGLGNVGYTLLEYRLGHKDLLRGLFENLIWVPFFFFFFGGLSIHISV
AILAHLFSYNITWGATKKEVERSNFWKEVPKILKRFRVALIICAIVTIAMIVLATPLVPL
AYRIPIYSWAVVLPLAIAIAGHVLYPVVLNPWLMIFSY

Enzyme Prediction     

No EC number prediction in CC1G_04713-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	494	711	7.7e-60	0.9746192893401016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.66e-53	494	704	1	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.11e-10	453	817	96	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.67e-06	453	602	38	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP01253.1|GT0	0.0	1	856	1	856
BAC77594.1|GT0	0.0	2	878	39	927
CCA73141.1|GT0	0.0	2	878	36	994
CCA73139.1|GT0	0.0	1	878	6	924
CCA70385.1|GT0	0.0	2	878	4	919

PDB Hits     

CC1G_04713-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_04713-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000086	0.000000

TMHMM  Annotations     

Start	End
243	265
277	299
691	713
725	744
766	788
820	842
846	868