CAZyme Information: CC1G_04646-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_04646-t26_1-p1
• CAZy Family: CE15|CE15|CE15|CE15|CE15|CE15|CE15|CE15|CE15
• CAZyme Description: glycosyl hydrolase family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36982.66	7.8974

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000003:702232-703430(-)

Full Sequence      

MKFSLLTTVFLAITAANAQLDARIKAKGKRYYGNILDRNTLNDGTITNILNTEFGAITAE
NSMKWDATEPSRGNFQWGGADQVANWATQRGKLLRGHTLVWHSQLPGWVNNIWDRNTLIQ
VIQNHIAQVAGRYRGRIYAWDVVNEVFEDNGQWRNSVFYRVLGEEFVDISFRAARAADPN
AKLYINDYNLDYAGPKIDATLALVGRLRQRGVPIDGIGTQAHLIVGRIGNFEAQLKRLGD
TGLDVAITELDIRIPRPVDQGKLQQQQRDYEAVTRACLNVPQCVGITIWGVSDRHTWVDG
TFPGDDSPLLWDDNYRRKPAYDGVNAALN

Enzyme Prediction     

EC	3.2.1.8:45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	20	325	4.3e-110	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	6.42e-162	20	324	1	308	Glycosyl hydrolase family 10.
214750	Glyco_10	1.78e-131	63	324	1	263	Glycosyl hydrolase family 10.
226217	XynA	1.79e-92	4	329	4	342	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV96034.1|GH10	9.49e-127	1	329	1	316
QRV78299.1|GH10	1.03e-123	1	329	1	316
QRW07234.1|GH10	1.03e-123	1	329	1	316
QRV93026.1|GH10	4.17e-123	1	329	1	316
QRV93093.1|GH10	5.92e-123	1	329	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUY_A	6.11e-108	16	328	2	302	Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Aspergillus niger [Aspergillus niger CBS 513.88],4XUY_B Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Aspergillus niger [Aspergillus niger CBS 513.88]
1GOK_A	7.26e-107	16	324	2	297	Thermostable xylanase I from Thermoascus aurantiacus- Crystal form II [Thermoascus aurantiacus],1GOM_A Thermostable xylanase I from Thermoascus aurantiacus- Crystal form I [Thermoascus aurantiacus],1GOO_A Thermostable xylanase I from Thermoascus aurantiacus - Cryocooled glycerol complex [Thermoascus aurantiacus],1GOQ_A Thermostable xylanase I from Thermoascus aurantiacus - Room temperature xylobiose complex [Thermoascus aurantiacus],1GOR_A THERMOSTABLE XYLANASE I FROM THERMOASCUS AURANTIACUS - XYLOBIOSE COMPLEX AT 100 K [Thermoascus aurantiacus]
1K6A_A	7.26e-107	16	324	2	297	Structural studies on the mobility in the active site of the Thermoascus aurantiacus xylanase I [Thermoascus aurantiacus]
1TUX_A	9.63e-107	15	324	1	297	High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus [Thermoascus aurantiacus]
2BNJ_A	1.03e-106	16	324	2	297	The xylanase TA from Thermoascus aurantiacus utilizes arabinose decorations of xylan as significant substrate specificity determinants. [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CHQ0|XYNC_ASPCL	5.57e-109	9	328	12	317	Probable endo-1,4-beta-xylanase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=xlnC PE=2 SV=1
sp|I1RQU5|XYN1_GIBZE	6.65e-109	20	321	21	333	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|Q4P902|XIN1_USTMA	3.88e-108	16	329	37	340	Endo-1,4-beta-xylanase UM03411 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_03411 PE=1 SV=1
sp|O60206|XLNA_AGABI	5.42e-108	19	324	18	327	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	7.56e-108	14	324	88	402	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999758	CS pos: 18-19. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in CC1G_04646-t26_1-p1.