CAZyme Information: CC1G_04166-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_04166-t26_1-p1
• CAZy Family: CBM21
• CAZyme Description: exoglucanase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		43967.43	6.8542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:3525820-3527198(+)

Full Sequence      

MKYLNLLAALLAVAPLSLAAPSIEARQSNVNPYIGKSPLVIRSYAQKLEETVRTFQQRGD
QLNAARTRTVQNVATFAWISDTNGIGAIRPLIQDALAQQARTGQKVIVQIVVYNLPDRDC
SANASTGEFTVGNDGLNRYKNFVNTIARELSTADADKLHFALLLEPDALANLVTNANAPR
CRIAAPAYKEGIAYTLATLSKPNVDVYIDAANGGWLGWNDNLRPSAELFKEVYDLARRIN
PNAKVRGLAVNVSNYNQYRAEVREPFTEWNDAWDESRYVNVLTPHLNAVGFPAHFIVDQG
RGGKGGIRTEWGQWCNVRNAGFGIRPTADQGVLQNPNVDAIVWVKPGGESDGTSDLNSNR
YDPTCRSPVAHVPAPEAGQWFNEYVVNLVLNANPPLEPTW

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	51	359	4.2e-85	0.9693877551020408

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	4.81e-141	60	360	1	293	Glycosyl hydrolases family 6.
227616	CelA1	3.57e-41	21	396	14	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAH08703.1|GH6|3.2.1.91	1.40e-299	1	400	1	400
BAH08705.1|GH6	5.15e-218	1	398	1	401
BAH08704.1|GH6|3.2.1.91	2.02e-217	1	400	1	402
BAH08706.1|GH6	9.78e-194	1	400	1	399
CAE7193877.1|GH6	2.11e-124	30	400	38	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A64_A	1.16e-208	22	400	5	383	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	1.91e-207	22	400	5	383	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	1.88e-114	28	396	5	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	3.05e-113	28	396	5	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
5XCY_A	1.78e-100	31	396	4	358	Chain A, Glucanase [Phanerodontia chrysosporium],5XCZ_A Chain A, Glucanase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	1.26e-109	9	400	43	415	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|P49075|GUX3_AGABI	3.76e-105	31	396	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	8.37e-99	19	397	16	365	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|A2QYR9|CBHC_ASPNC	2.58e-93	14	394	84	457	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|Q9C1S9|GUX6_HUMIN	2.98e-93	29	395	116	475	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999749	CS pos: 26-27. Pr: 0.6772

TMHMM  Annotations     

There is no transmembrane helices in CC1G_04166-t26_1-p1.