CAZyme Information: CC1G_04059-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_04059-t26_1-p1
• CAZy Family: CBM1|CE3
• CAZyme Description: glycosyl hydrolase family 5 protein/cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		50658.51	8.3073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:3233657-3235118(+)

Full Sequence      

MSSARRPDAVTTTCFATPVLEDTRALEHDNSTLRCRRAASSPIRRRNIHSNTLHIPLAAS
LFPTHINAVVLRSSGRWILDASTGQRVKLRCVNWAGHMETNIPEGLQHQPASTIAQWIAT
NRFNCVRLTFSIDMALNPNQRVSDSFTAAAGPAGVSVSEMQGLYNQALSKNPWLSSSTTR
GAFARVIQELEARNVLVVLDNHVSRASWCCSTNDGNGWWASASGYDANNSRYFDTNNWLN
GLRSMASFSHSHPNVVGIALRNELRAVGNQDRNNHADWYNYITQGAQAVRGANSNLLVVV
GGVNYALDLSFVWNRMLDRNVFGDKLVWELHNYAWSGGGRDCNNHQKMMGDRGGFVLIQN
REFTGPLFLSEFGWAQNNPSADEIAYSSCLVRYLESNDAEWAYWALQGSYYVRERRVNFD
ETFGLLNHDWSGWRNGSFVRTLGKMWDVTQGP

Enzyme Prediction     

No EC number prediction in CC1G_04059-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	81	406	1.2e-102	0.9904153354632588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.59e-07	253	406	120	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14302.1|GH5_11	3.97e-148	71	452	22	409
QKX58257.1|GH5_11	7.38e-143	71	452	20	407
AEO69593.1|GH5_11	8.60e-140	68	452	24	420
AEO57401.1|GH5_11	3.74e-135	57	452	15	427
UQC77964.1|GH5_11	1.56e-131	71	452	26	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TUF_A	7.72e-09	73	442	4	343	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	5.27e-75	63	452	25	401	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P19487|GUNA_XANCP	5.81e-08	73	442	29	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999845	0.000196

TMHMM  Annotations     

There is no transmembrane helices in CC1G_04059-t26_1-p1.