CAZyme Information: CC1G_03941-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03941-t26_1-p1
• CAZy Family: CBM13
• CAZyme Description: pyranose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		63977.07	9.7611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000007:471656-473917(-)

Full Sequence      

MVSYYPAILVLLLTFALWGAAPRVFVHAELLGHVDQLADKTFDFIIAGGGAAGSVLASRL
SENPKFGVLLVEAGPDNVGVLEIMAPGLAFQIPRTYNWNFVSVPQRGLDNRAINIPRGHV
LGGSTCINGMLYTRGSSDNYDNWARNVGDQQWSWKALWPYFKKHERWVAPVGNRSIEGQY
DPKAHGYNGKTFVSLPTKGPDEHSFRCLNNTKLQPKLFPLTLDINGGKPVGLTWTQWSIG
KGERSSAATSYLTPDVRRRPNLTILVNAYVTRVVPSSVNGPLDIRTVEIAPRAGGASKTL
TAKKEVILSAGSFGTPRILLSSGIGNKTELDLIGVKVIHDLPDVGEGLTDHAAIEARWGT
TATHLPPVDPAEALAEWQANRTGPLTMSSVSSPQLLWNRISSDSPVFKKYRDPAPGPNSP
HIEMTLRSPGGPVTPESIVLLTPYSSQHPPSRRKLPMLTPPSNGMHISGGTVKINSTNPF
DDPLIDYNFLGHPFDIEAFKEGIRLGKKFYSGPVWQGYRTSFLGPDPETLSEDEFLNAIK
PMVSSWQHPVGTAAMSKRGSKQGVVNPDLRVKGVRGLRIVDASVIVSL

Enzyme Prediction     

No EC number prediction in CC1G_03941-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	585	1e-139	0.9524647887323944

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.01e-95	38	584	2	507	choline dehydrogenase; Validated
225186	BetA	4.28e-88	38	585	4	510	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	5.99e-30	109	351	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.18e-27	468	585	3	124	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.94e-25	39	584	53	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAZ94874.1|AA3_2	3.38e-117	33	585	31	572
AHA85313.1|AA3_2|1.1.99.29	1.63e-116	33	588	27	570
AAW82996.1|AA3_2|1.1.99.29	1.56e-115	33	585	31	574
AAW82997.1|AA3_2|1.1.99.29	1.56e-115	33	585	31	574
AHA85314.1|AA3_2|1.1.99.29	1.63e-114	12	585	12	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	5.39e-117	33	585	31	574	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	3.72e-110	42	585	2	538	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.83e-110	42	585	3	539	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	7.77e-60	40	583	4	557	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	7.67e-52	40	583	15	562	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	6.01e-118	33	585	31	572	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|V5NDL4|PDH1_AGACM	2.90e-117	33	588	27	570	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	2.77e-116	33	585	31	574	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|V5NC32|PDH1_AGAXA	2.89e-115	12	585	12	572	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	6.82e-115	35	585	34	566	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.332455	0.667523	CS pos: 22-23. Pr: 0.5430

TMHMM  Annotations     

Start	End
2	21