CAZyme Information: CC1G_03818-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03818-t26_1-p1
• CAZy Family: CBM13
• CAZyme Description: glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		91554.72	4.9998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:2325361-2328325(-)

Full Sequence      

MQTRWLLFLPVLPAVLAQGANDTLLWGAYRPNLYFGLRPRIPESLMTGMMWFGTQDFMSI
GNSYTWTEYDPREGGVQVLKDSFNNVKITTEFLKIPGGLHGGSWAARIRGEPLRPEDPSR
ISVIYYAGLEGLGNLGMETDERENGIDGEVEFSGNTIELGDFTLRVVDGPDNKYIKDGAH
YEDFKRSVEKTQFLGRAVERGNIWKAKDIIIAAMAEKFREVMPAYQPDFPNPGYVLTLPN
DVYTNSNFFAVQKTFDGPFQFDVLFESGSAKQKLSSSTLDEGIPALIEAYNQRFRATLPH
PADYPTEKQSSLEAFSKAVTSNLIGGVGYFYGNSIVDRKFSYEWDQDEDAGDDDDAKPSG
SHLTEPKSLLTATPSRSFFPRGFYWDEGFHLLHIGQWDNDFSLEILKDWINLIDDNGWVA
REQILGEEARSKVPVEFQTQVPNYANPPTLVTVVAAFIERLKSVNANRGPSDEDLGMGMG
GAQTPLGVQDEATPVPGTQHLQDQELAFSYLKSIYAPLKRHYEWFRRTQRGQIKQYGRKA
RSRTEGYRWRGRTEEHVLTSGMDDYPRGPPHPGELHLDLISWMAFFSRTMKDISGFIGEK
EDQANFAKYERAILDNIEDLHWNEEENMYCDVGVNEDDESYHICHKGYLSLFPFLLSLLP
PDSPHLGSILELVRDPEHLWSSYGIRSLSASHPQFGKGENYWKGPIWIQMNYLALSALHK
TYAAQPGPYQERAQEIYKELRRNVVDNVVKVCPHASRRFCLDDPYMIPQEYERTGYVWEQ
YNPLTGEGQRRHVPLDLCCQHRC

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	575	790	2.1e-18	0.40350877192982454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	6.17e-173	274	792	1	479	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.48e-98	24	230	1	220	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	2.12e-04	663	738	496	563	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO98679.1|GH63	0.0	1	792	1	754
KAF9232974.1|GH63	0.0	16	792	42	755
CCA74001.1|GH63	0.0	17	792	28	784
QRW00106.1|GH63	2.49e-296	50	792	1	727
QRW14633.1|GH63	2.02e-295	50	792	1	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.05e-156	21	788	12	783	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	2.23e-114	24	788	37	758	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	4.96e-207	18	790	36	789	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.92e-155	21	788	42	813	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.79e-114	24	788	92	813	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	2.38e-110	26	788	94	813	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.55e-110	10	788	79	816	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999737	CS pos: 17-18. Pr: 0.9818

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03818-t26_1-p1.