CAZyme Information: CC1G_03654-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03654-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502		54766.01	9.3641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000001:1948372-1949985(-)

Full Sequence      

MLYEESVDSEERGLRDLHLAYHRGALQLHKRSHNRRAQSAFNLVDVSVPTNVVSSLVASI
TVPAVPINPVGTSSTDSTTSKGTRPPAQAAAKTTKTTCTPSPTTSMAPSATWTTCRYIGR
DGKVNPDVRGLNGPSAINSLSQYVLYGCISAVVNKDSKHAKEAVAAVDRFFLSPSTGMNP
NLKYGQVVRGPGPAGISGTFTGILDLRGTVKIVNGLMLLRELAHPDWTDKRDSAMRSWLS
QYGQWLTHSDIGKMTGSRPKYAPIFPSWVPLNHVPSNHGTFYVSQLAAAKIFEGSKEEAI
SILVQFFKKQFIDQIAASGEQPFEAVRTRPYHYRCFNIEALITNAKLGDQLGLDLWSSRS
KYGATIQTAMDFIIASDPKGEKASEAVPHVAAVAAAYGDPKGKYAAFLKKHLSNYQSKPF
WFYDQPRAVSRDSSKKMVKQSDASGNGQEADHDGASTGTPKSPNIPFTCPDVFKDATRVE
IDNGIFVTCDELRPFYELPMPI

Enzyme Prediction     

No EC number prediction in CC1G_03654-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	110	254	4.6e-32	0.4946236559139785
PL38	276	375	1.5e-24	0.3548387096774194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	7.87e-42	106	379	19	272	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW04926.1|PL38	1.01e-112	111	496	316	678
QRV90823.1|PL38	4.43e-106	112	496	293	647
QRW18874.1|PL38	4.42e-95	98	496	308	721
QRW19896.1|PL38	8.63e-77	104	421	100	402
QRW05956.1|PL38	5.60e-71	103	426	99	408

PDB Hits     

CC1G_03654-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_03654-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03654-t26_1-p1.