CAZyme Information: CC1G_03616-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03616-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: Cap3p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		82967.45	6.1036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:1973710-1976169(-)

Full Sequence      

MVSFRLHRLPLRTAILFILLAVILCTQVSSWIPSFDVYTHLRPHDVEEERPCKVDNLVLT
RTATTTVFSPPQTVTVQEPVHTTESRDVFGFPVVGSRAPPPSDAVDETRQTTHHFYRDDG
LLEVNPDGPHPIFELMEQAEQRWKKKNEKASRTLKEACEEYERRYNRKPPHGFDVWWIYV
QSYDVRLPDEYDQISKNMEPFWGIDPRRLQQIQRDWEDYTNTFTVGKETDTSPIEMVNHA
FDAEGGKSPRMTGAKMVADILEEVSSFLSPFRAVFSSDDNPNLHTDYELMKMAIQAGKEG
RYIDIDNPPPVKLDGWISACPPDSPAWVNRVEYTNPLPPLPELSRMKHNTAYASSPSSPE
ALPPKTFIHNHKLSMDPCLHPAHLLMHGQFISHERGPVPHRLIIPQFSFSPTSLHHDITV
ALSINWIDDIRPRGHDPLFDDKDDERLQWRGSNTGSWFGGNTQWWVSHRTRLVDWANPRR
LQPSTVDSVLWSPPDSRWKVGEPSVPPSKSAWAPAMADIAFANKPISCAPEVCNGRLAQE
YEFRHPHNIPTQGKYKYIIDVDGNAWSSRFKRLITSNSLIFKSTIYQEWFADRIEPWLHY
VPIQIDYSDLLDALYFFRGDPGGRGAHPELAKKIAEAGREWSLTHWRRADLTAYMFRLFL
EYTRIMSPERENGGLDYVYDEADEFDPDVPVFGAEEEAEPRSGQSLFLRAMEKRRQCRAP

Enzyme Prediction     

No EC number prediction in CC1G_03616-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	402	666	7.6e-56	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.59e-22	552	666	143	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.77e-17	548	673	209	332	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW03676.1|GT90	3.37e-138	114	672	117	646
QRV74770.1|GT90	3.37e-138	114	672	117	646
QRV89460.1|GT90	4.75e-138	114	672	117	646
CCA67199.1|GT90	9.17e-132	114	671	90	619
CDR40950.1|GT90	7.49e-115	99	680	127	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.07e-14	554	667	236	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	9.33e-11	554	669	271	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.69e-85	100	678	121	668	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.64e-15	554	687	360	488	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.65e-15	530	669	327	470	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	2.06e-14	554	667	264	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.74e-14	554	667	264	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.042526	0.957444	CS pos: 30-31. Pr: 0.9152

TMHMM  Annotations     

Start	End
13	35