CAZyme Information: CC1G_03507-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03507-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: arabinogalactan endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		38827.63	6.4873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:1694093-1695415(-)

Full Sequence      

MQLASFSWFLWLFSLISSVHAITYRGADFSSLVNLENQGIRYRDNGNVQPLERILANYGA
NLARIRVWTSNDYSQYSLNYALNLAKRAQAAGMDIYVDLHYSDSWADPGKQWIPSSWPKD
LAGLNTQIYTYTRDVVRAFQNQGTPIKYIEIGNEINDGMLWPVGRISQNGYGNLSELLHS
AAAGVRDASSSVKIMVHLANGWNWSAVNGFFNQIFMPGKFATSDVDVLGFSFYPFYGTSA
TLNNLRSSLTNIVNKLNKEVMVVEVNWPYYCPDVALSEPGYPTGASGQLSFVNQVRSIVE
NLPNGRGTGIVYWEPGWIGNAGLGSACWDNILVDGSGNVRSPSFNMFNR

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	24	345	2.1e-95	0.9912280701754386

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	4.51e-107	24	347	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	1.88e-73	25	348	41	392	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV30323.1|GH53	9.22e-153	9	347	7	350
AAQ77827.1|GH53|3.2.1.89	6.66e-136	3	349	9	341
AEO65375.1|GH53	5.76e-104	21	341	19	342
CDP24039.1|GH53	8.43e-104	21	349	20	350
CAP67782.1|GH53	8.43e-104	21	349	20	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HJS_A	2.05e-103	21	349	1	331	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	1.23e-99	21	349	1	331	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1FHL_A	3.01e-98	21	334	1	318	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	1.12e-94	21	347	18	347	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1R8L_A	1.31e-40	16	318	17	325	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P83692|GANA_THETO	1.05e-102	21	349	1	331	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
sp|P83691|GANA_HUMIN	6.34e-99	21	349	1	331	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1
sp|Q9Y7F8|GANA_ASPTU	8.00e-99	15	334	12	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|A1D3T4|GANA_NEOFI	2.75e-98	21	347	22	353	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
sp|A2RB93|GANA_ASPNC	3.21e-98	15	334	12	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999757	CS pos: 21-22. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03507-t26_1-p1.