CAZyme Information: CC1G_03477-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03477-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	AACS02000009|CGC8	58062.37	6.7807

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:1619636-1621689(-)

Full Sequence      

MPQLPSSLVVAVSLLSVVRALNVTLPARAPSSANSIAPDHFSLSIELDGWLNWIGNDTRN
EFFYNALDNIVRLTGVPPRIRVGGKSQDKTFWAQTADTITAVYPPATDDVPFPEPLRVTV
GDNFYYKSLFLPDNTKLIHGLNFQSMDSLRGVYHLNSILNSYSVLPEFKERNIRLDAVEA
GHEPDLYDNKYPPPYTPQKYVNEWTSWTSGVLDFIPFLHPEIHEYGLKYWAGSLSASSRE
SDAGFSPHALFKEGLLTKTKAGTAITTVSQHHYSGGSNCASSATLQDFVGKSQVRSSLSV
LSTDISVTRANKLEYVLGETGILSCQKAGVSNVAGSVIWSLDYLLQAAQLGVSRVFFHQR
IGSLSNIIQPSPLSRSPIDGKELSSPLQPHVQPQYYAAIIAAEAIGSSGNVRVSELKIDN
PSVSAYAFYEGNTLSRAIFINSQVYRRSDGRRPSVRVTLNLPGQGPRIQPAILKRLAIAS
ADDTSNLSWGGVTYETEDARPSGREWREHIIPGQGFDLRATEVVLVSFD

Enzyme Prediction     

No EC number prediction in CC1G_03477-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	55	448	2.7e-41	0.7978021978021979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	4.60e-21	425	525	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KNX50052.1|GH79	4.20e-72	22	529	30	533
KNX50051.1|GH79	1.37e-68	22	529	31	534
AAW45659.2|GH79	1.37e-68	22	528	32	533
ADV23930.1|GH79	1.92e-68	22	529	31	534
ADV23890.1|GH79	1.44e-67	22	529	31	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	2.13e-19	66	529	46	460	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5BWI_A	9.33e-07	24	427	18	349	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	6.69e-28	8	501	7	515	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	7.97e-28	42	500	55	504	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999732	CS pos: 20-21. Pr: 0.9676

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03477-t26_1-p1.