CAZyme Information: CC1G_03407-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03407-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	AACS02000008|CGC8	81053.06	4.2497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:746450-749346(+)

Full Sequence      

MEKYRVALMALCSLGLALETAGQSASSDAPPVATATPSPTGGLNEPLPSQVPVPPRQEWC
TSEIFCAGPLLQTVNIAHVYPDDKTFVDKPTSKPPQEVLNDFRNISTNTTYGQVVAFLEE
AFSGEGLELEPLTLQNFNPEPAFLNNVTNPLVRAFSQAVHTFWTQLIRGTNQETVCGNTG
RCESTLIPLNHTFVVPGGRFREQYYWDSFWILEGLLESELNDIANATLQNFMDELDTIGF
IPNGGRTYYLNRSQPPMFIQMLARYVQVTGDTDILARGLPLAEKELAWWSSERSVSVQSP
FTNQTHEVYRYAVTNSAPRPESYLTDYLTANDPELPVLNETERADLYAELASGAESGWDY
TGRWYSPGGTSLRDLHVRSTIAVDLNSILYRSHVELANLYGSSNETAANRHREAAERIRQ
AILDLCWDSEKLAFYDFSILTNDRNEWFTAAHYYPFWSGIIPDEVLSSEEAAFGAFSSLN
LVLNRYNGTFPATFVDTHLQWDAPNSWPPHQYIVLQALRALPANVSSGPLPQPSDDESTF
SLVPAGQLGLEETELPGQPVTFSRNASATGSSADINRLDGTVFNGGNATEGEGWAAALGR
QLANRYFASTLCSWHATGGSIEGVLPRLSDEELAVTESLDQNGHMFEKFSNLDIDSAGRG
GEYVVQAGFGWTNGVLLWVASNYGGALTTPECPNLLEVPTAPKPGSGSGSEDEDGGSLGR
IHNAAASWLIAGLLFFWML

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	80	522	4.3e-123	0.8655804480651731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.69e-110	80	684	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.20e-101	65	685	13	546	alpha,alpha-trehalase
224541	TreA	2.48e-68	68	520	59	485	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.48e-66	5	689	8	542	alpha,alpha-trehalase TreA.
237326	treA	2.33e-59	44	519	33	469	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI56844.1|GH37	0.0	8	697	9	713
CCA76060.1|GH37	1.14e-265	23	700	45	775
QRW20035.1|GH37	8.35e-249	37	696	59	736
QRV92208.1|GH37	8.15e-244	90	696	112	736
QRV77412.1|GH37	1.15e-243	90	696	112	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z66_A	6.23e-55	61	519	45	472	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	3.14e-53	68	519	15	435	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	3.96e-52	68	519	15	435	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	2.99e-49	81	684	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	3.62e-48	81	684	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	3.81e-103	60	692	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P19813|TREA_RABIT	7.52e-96	47	697	18	563	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	1.07e-93	60	691	41	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|O43280|TREA_HUMAN	2.77e-92	47	689	18	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q8MMG9|TREA_PIMHY	3.07e-91	53	691	38	577	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999757	CS pos: 22-23. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03407-t26_1-p1.