CAZyme Information: CC1G_03095-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03095-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
941		105441.65	7.7210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:2245047-2248405(+)

Full Sequence      

MSRYPPEADEGQRRHYNDGTYNYPAYDPYEPQQPNPYDNHPNPYDRNYNDPFTGSPTTTT
NPFNTPGPPPPLHPSAYGNAPPLAIPTPPPPPPHVIPSASPPMLTHTPLPPPGHVQFQVA
PPQPPGTPLSTGYRRSAYEPDDDGGMDAGDIPLLRRDPASDSSLLRPPSAMPVPVNYDDN
RSPSTAPEDTTNIRYGRIPQRVPRRYKTVKKVELFHGNFVLDNAVPPKLLDMCPNRHDRE
FTHMRYSAATCDPNDFKDSGFTLRQVHYDPPRKTELFIVMTMYNEDEELFCRTMHGVIKN
IAHLCKRDRSKTWGKEGWKKVVVCIVSDGREKINSRTLSVIAAMGAYQEGIAKTKVGTKD
VTAHIYEYTTQISVTPSMKIETSTSGTVPVQIIFCLKEKNQKKINSHRWFFNAFGPILEP
NVCVLLDVGTMPGPTSIYHLWKAFDINSNVGGACGEIVALKGKYGLNLVNPLVAAQNFEY
KMSNILDKPLESVFGYITVLPGAFSAYRYIALQNDPATGEGPLRQYFLGESMHGAGADIF
TANMYLAEDRILCWELVSKRGGAWTLHYVKSAYAVTDVPDQVPELISQRRRWLNGSFFAA
VHSVFHFHYLYRSSHSFMRKFWIHVEMFYQLFNLIFAWFSLANYYIAFNILCTAMEDPSF
GLKGINIFNIIINYFYVGLLLMCFILSLGNRPQGAKWFYTMAMIGFALITVYMTFAAFFL
AVKGIQAIGRETDGGITFGTFFENSIFRNIILSLAATLGLYLLASLIFFEPWHMITSFLQ
YLLMAPSYISVLNVYAFANVHDVSWGTKGDNKAPTSLGTVPTSKNKNEVEVELPTSEKDI
NALYEDAIHVLNTKPPKQEAKVDAGQKQEDYYRNFRTNVLLAWTLTNGLLAAAITSTASK
DGAGKAVEGYMAFLLFSVAGLAFVRFIGSTTYMIVRLFAGE

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	282	444	1.6e-80	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	9.78e-118	282	444	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.68e-96	278	599	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	2.16e-35	211	281	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.58e-28	393	731	115	437	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.32e-15	278	512	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO98184.1|GT2	0.0	142	941	135	931
BAF76741.1|GT2	0.0	1	941	1	927
BAF76742.1|GT2	0.0	1	941	1	927
CCA75477.1|GT2	0.0	160	941	241	1030
AZQ26798.1|GT2	0.0	136	941	129	902

PDB Hits     

CC1G_03095-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99127|CHS4_USTMA	0.0	193	941	202	942	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|J9VGT6|CHS8_CRYNH	0.0	188	941	286	1032	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|P30595|CHS2_RHIOL	1.53e-314	192	940	103	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P87073|CHS1_PHYB8	4.14e-310	192	940	86	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	3.77e-297	196	940	105	858	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
631	653
666	688
698	720
746	768
778	800
877	899
909	928