CAZyme Information: CC1G_03040-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03040-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		29824.32	9.3590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:2109090-2109985(+)

Full Sequence      

MNPTLFAAIFLSLAITVQSAINDACTVKGQPGICITTSACSSAGGTSTAGFCLKDPANIR
CCTKSCSNGGTCRFTATCASGNTLSGNFTTTSPLLGGRCPGPSNFKCCLPGPRDSKPCPG
TTVNARTVREIKSSEGFVKSPAPDPIGLPTVGYGHLCKTKGCAEVPYKFPLTDAQATSLL
KSDLKTFQNCISKDLRDTVRLNENQYGALVSWAFNVGCRATGSSTLIARLNRGDNPAKVA
EEELPKWNKANGKVLQGLVNRRKREIAMFKTPSKVIHHPPKC

Enzyme Prediction     

No EC number prediction in CC1G_03040-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	125	265	1.2e-39	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	2.74e-56	131	269	5	135	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	2.32e-34	122	268	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	4.61e-32	119	272	3	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381619	endolysin_R21-like	1.98e-31	131	268	12	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
395766	Phage_lysozyme	1.28e-18	149	263	2	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76536.1|GH24	1.22e-65	1	282	1	268
QSS63085.1|GH24	2.88e-59	114	274	24	182
UNI22263.1|GH24	4.99e-57	110	273	99	262
QBZ63741.1|GH24	5.38e-56	29	281	27	355
UPL03217.1|GH24	2.31e-54	118	282	24	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.02e-18	120	269	49	193	Chain A, Lysozyme [Acinetobacter baumannii]
2ANV_A	1.21e-15	123	269	4	144	Chain A, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6H9D_A	1.17e-12	128	272	11	149	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
7M5I_A	2.61e-11	131	269	17	153	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11187|ENLYS_BPPH2	6.61e-20	150	275	32	150	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|D4ATA2|A7466_ARTBC	1.01e-19	11	110	12	102	Uncharacterized secreted protein ARB_07466 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07466 PE=1 SV=1
sp|P07540|ENLYS_BPPZA	1.27e-19	150	275	32	150	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|Q37896|ENLYS_BPB03	1.14e-15	150	271	32	144	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|P09963|ENLYS_BPP22	3.24e-15	123	269	4	144	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999760	CS pos: 19-20. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03040-t26_1-p1.